Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	129607
Gene name	Cytidine/uridine monophosphate kinase 2
Gene symbol	CMPK2
Synonyms (NCBI Gene)	IBGC10NDKTMPK2TYKiUMP-CMPK2
Chromosome	2
Chromosome location	2p25.2
Summary	This gene encodes one of the enzymes in the nucleotide synthesis salvage pathway that may participate in terminal differentiation of monocytic cells. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefS

196

Show/Hide all (196)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026932	hsa-miR-192-5p	Microarray	19074876
MIRT898816	hsa-miR-1248	CLIP-seq
MIRT898817	hsa-miR-224	CLIP-seq
MIRT898818	hsa-miR-3176	CLIP-seq
MIRT898819	hsa-miR-3647-3p	CLIP-seq
MIRT898820	hsa-miR-3658	CLIP-seq
MIRT898821	hsa-miR-3922-3p	CLIP-seq
MIRT898822	hsa-miR-4255	CLIP-seq
MIRT898823	hsa-miR-4326	CLIP-seq
MIRT898824	hsa-miR-4643	CLIP-seq
MIRT898825	hsa-miR-466	CLIP-seq
MIRT898826	hsa-miR-4714-3p	CLIP-seq
MIRT898827	hsa-miR-4757-5p	CLIP-seq
MIRT898828	hsa-miR-4789-3p	CLIP-seq
MIRT898829	hsa-miR-4789-5p	CLIP-seq
MIRT898830	hsa-miR-595	CLIP-seq
MIRT898831	hsa-miR-599	CLIP-seq
MIRT898832	hsa-miR-656	CLIP-seq
MIRT898833	hsa-miR-889	CLIP-seq
MIRT898817	hsa-miR-224	CLIP-seq
MIRT898826	hsa-miR-4714-3p	CLIP-seq
MIRT1966461	hsa-miR-1305	CLIP-seq
MIRT1966462	hsa-miR-3120-5p	CLIP-seq
MIRT1966463	hsa-miR-4682	CLIP-seq
MIRT1966464	hsa-miR-626	CLIP-seq
MIRT2202333	hsa-miR-1184	CLIP-seq
MIRT2202334	hsa-miR-1205	CLIP-seq
MIRT2202335	hsa-miR-122	CLIP-seq
MIRT2202336	hsa-miR-1286	CLIP-seq
MIRT2202337	hsa-miR-145	CLIP-seq
MIRT2202338	hsa-miR-3064-3p	CLIP-seq
MIRT2202339	hsa-miR-3158-5p	CLIP-seq
MIRT2202340	hsa-miR-3194-3p	CLIP-seq
MIRT2202341	hsa-miR-3925-3p	CLIP-seq
MIRT2202342	hsa-miR-4328	CLIP-seq
MIRT2202343	hsa-miR-4433	CLIP-seq
MIRT2202344	hsa-miR-4722-5p	CLIP-seq
MIRT2202345	hsa-miR-4727-5p	CLIP-seq
MIRT2202346	hsa-miR-4769-3p	CLIP-seq
MIRT2202347	hsa-miR-544	CLIP-seq
MIRT2202348	hsa-miR-760	CLIP-seq
MIRT2505268	hsa-miR-103b	CLIP-seq
MIRT2505269	hsa-miR-1231	CLIP-seq
MIRT2505270	hsa-miR-1243	CLIP-seq
MIRT2505271	hsa-miR-1272	CLIP-seq
MIRT2505272	hsa-miR-1292	CLIP-seq
MIRT2505273	hsa-miR-1297	CLIP-seq
MIRT2505274	hsa-miR-1299	CLIP-seq
MIRT2505275	hsa-miR-130a	CLIP-seq
MIRT2505276	hsa-miR-130b	CLIP-seq
MIRT2505277	hsa-miR-141	CLIP-seq
MIRT2505278	hsa-miR-181a	CLIP-seq
MIRT2505279	hsa-miR-181b	CLIP-seq
MIRT2505280	hsa-miR-181c	CLIP-seq
MIRT2505281	hsa-miR-181d	CLIP-seq
MIRT2505282	hsa-miR-199a-5p	CLIP-seq
MIRT2505283	hsa-miR-199b-5p	CLIP-seq
MIRT2505284	hsa-miR-200a	CLIP-seq
MIRT2505285	hsa-miR-203	CLIP-seq
MIRT2505286	hsa-miR-217	CLIP-seq
MIRT2505287	hsa-miR-2467-3p	CLIP-seq
MIRT2505288	hsa-miR-2467-5p	CLIP-seq
MIRT2505289	hsa-miR-26a	CLIP-seq
MIRT2505290	hsa-miR-26b	CLIP-seq
MIRT2505291	hsa-miR-301a	CLIP-seq
MIRT2505292	hsa-miR-301b	CLIP-seq
MIRT2202338	hsa-miR-3064-3p	CLIP-seq
MIRT2505293	hsa-miR-3122	CLIP-seq
MIRT2505294	hsa-miR-3126-5p	CLIP-seq
MIRT2505295	hsa-miR-3145-5p	CLIP-seq
MIRT2505296	hsa-miR-3156-3p	CLIP-seq
MIRT2505297	hsa-miR-3156-5p	CLIP-seq
MIRT2505298	hsa-miR-3165	CLIP-seq
MIRT2505299	hsa-miR-324-5p	CLIP-seq
MIRT2505300	hsa-miR-346	CLIP-seq
MIRT2505301	hsa-miR-3646	CLIP-seq
MIRT2505302	hsa-miR-3649	CLIP-seq
MIRT2505303	hsa-miR-3654	CLIP-seq
MIRT2505304	hsa-miR-3655	CLIP-seq
MIRT898820	hsa-miR-3658	CLIP-seq
MIRT2505305	hsa-miR-3666	CLIP-seq
MIRT2505306	hsa-miR-3668	CLIP-seq
MIRT2505307	hsa-miR-3674	CLIP-seq
MIRT2505308	hsa-miR-3691-5p	CLIP-seq
MIRT2505309	hsa-miR-370	CLIP-seq
MIRT2505310	hsa-miR-3913-5p	CLIP-seq
MIRT2505311	hsa-miR-3915	CLIP-seq
MIRT2505312	hsa-miR-3924	CLIP-seq
MIRT2505313	hsa-miR-3928	CLIP-seq
MIRT2505314	hsa-miR-3935	CLIP-seq
MIRT2505315	hsa-miR-4261	CLIP-seq
MIRT2505316	hsa-miR-4262	CLIP-seq
MIRT2505317	hsa-miR-4280	CLIP-seq
MIRT2505318	hsa-miR-4287	CLIP-seq
MIRT2505319	hsa-miR-4288	CLIP-seq
MIRT2505320	hsa-miR-4295	CLIP-seq
MIRT2505321	hsa-miR-4301	CLIP-seq
MIRT2505322	hsa-miR-4310	CLIP-seq
MIRT2505323	hsa-miR-4434	CLIP-seq
MIRT2505324	hsa-miR-4436b-5p	CLIP-seq
MIRT2505325	hsa-miR-4465	CLIP-seq
MIRT2505326	hsa-miR-4469	CLIP-seq
MIRT2505327	hsa-miR-4471	CLIP-seq
MIRT2505328	hsa-miR-4496	CLIP-seq
MIRT2505329	hsa-miR-4516	CLIP-seq
MIRT2505330	hsa-miR-454	CLIP-seq
MIRT2505331	hsa-miR-4663	CLIP-seq
MIRT2505332	hsa-miR-4685-3p	CLIP-seq
MIRT2505333	hsa-miR-4695-3p	CLIP-seq
MIRT2505334	hsa-miR-4696	CLIP-seq
MIRT2505335	hsa-miR-4704-3p	CLIP-seq
MIRT2505336	hsa-miR-4712-3p	CLIP-seq
MIRT2505337	hsa-miR-4728-3p	CLIP-seq
MIRT2505338	hsa-miR-4755-3p	CLIP-seq
MIRT2505339	hsa-miR-4764-5p	CLIP-seq
MIRT2505340	hsa-miR-4773	CLIP-seq
MIRT2505341	hsa-miR-494	CLIP-seq
MIRT2505342	hsa-miR-495	CLIP-seq
MIRT2505343	hsa-miR-519a	CLIP-seq
MIRT2505344	hsa-miR-519b-3p	CLIP-seq
MIRT2505345	hsa-miR-519c-3p	CLIP-seq
MIRT2505346	hsa-miR-522	CLIP-seq
MIRT2505347	hsa-miR-576-3p	CLIP-seq
MIRT2505348	hsa-miR-605	CLIP-seq
MIRT2505349	hsa-miR-607	CLIP-seq
MIRT2505350	hsa-miR-632	CLIP-seq
MIRT898832	hsa-miR-656	CLIP-seq
MIRT2505351	hsa-miR-7	CLIP-seq
MIRT2505352	hsa-miR-758	CLIP-seq
MIRT2505353	hsa-miR-875-3p	CLIP-seq
MIRT898833	hsa-miR-889	CLIP-seq
MIRT2505268	hsa-miR-103b	CLIP-seq
MIRT2505271	hsa-miR-1272	CLIP-seq
MIRT2505272	hsa-miR-1292	CLIP-seq
MIRT2505273	hsa-miR-1297	CLIP-seq
MIRT2505275	hsa-miR-130a	CLIP-seq
MIRT2505276	hsa-miR-130b	CLIP-seq
MIRT2505277	hsa-miR-141	CLIP-seq
MIRT2505278	hsa-miR-181a	CLIP-seq
MIRT2505279	hsa-miR-181b	CLIP-seq
MIRT2505280	hsa-miR-181c	CLIP-seq
MIRT2505281	hsa-miR-181d	CLIP-seq
MIRT2505282	hsa-miR-199a-5p	CLIP-seq
MIRT2505283	hsa-miR-199b-5p	CLIP-seq
MIRT2505284	hsa-miR-200a	CLIP-seq
MIRT2505286	hsa-miR-217	CLIP-seq
MIRT2505289	hsa-miR-26a	CLIP-seq
MIRT2505290	hsa-miR-26b	CLIP-seq
MIRT2505291	hsa-miR-301a	CLIP-seq
MIRT2505292	hsa-miR-301b	CLIP-seq
MIRT2202338	hsa-miR-3064-3p	CLIP-seq
MIRT2505293	hsa-miR-3122	CLIP-seq
MIRT2505294	hsa-miR-3126-5p	CLIP-seq
MIRT2505295	hsa-miR-3145-5p	CLIP-seq
MIRT2505296	hsa-miR-3156-3p	CLIP-seq
MIRT2505298	hsa-miR-3165	CLIP-seq
MIRT2505302	hsa-miR-3649	CLIP-seq
MIRT2505305	hsa-miR-3666	CLIP-seq
MIRT2505306	hsa-miR-3668	CLIP-seq
MIRT2505307	hsa-miR-3674	CLIP-seq
MIRT2505308	hsa-miR-3691-5p	CLIP-seq
MIRT2505310	hsa-miR-3913-5p	CLIP-seq
MIRT2505311	hsa-miR-3915	CLIP-seq
MIRT2505312	hsa-miR-3924	CLIP-seq
MIRT2505313	hsa-miR-3928	CLIP-seq
MIRT2505314	hsa-miR-3935	CLIP-seq
MIRT2505315	hsa-miR-4261	CLIP-seq
MIRT2505316	hsa-miR-4262	CLIP-seq
MIRT2505317	hsa-miR-4280	CLIP-seq
MIRT2505320	hsa-miR-4295	CLIP-seq
MIRT2505321	hsa-miR-4301	CLIP-seq
MIRT2505322	hsa-miR-4310	CLIP-seq
MIRT2505324	hsa-miR-4436b-5p	CLIP-seq
MIRT2505325	hsa-miR-4465	CLIP-seq
MIRT2505327	hsa-miR-4471	CLIP-seq
MIRT2505328	hsa-miR-4496	CLIP-seq
MIRT2505330	hsa-miR-454	CLIP-seq
MIRT2505331	hsa-miR-4663	CLIP-seq
MIRT2505333	hsa-miR-4695-3p	CLIP-seq
MIRT2505334	hsa-miR-4696	CLIP-seq
MIRT2505335	hsa-miR-4704-3p	CLIP-seq
MIRT2505336	hsa-miR-4712-3p	CLIP-seq
MIRT2505337	hsa-miR-4728-3p	CLIP-seq
MIRT2505339	hsa-miR-4764-5p	CLIP-seq
MIRT2505340	hsa-miR-4773	CLIP-seq
MIRT2505341	hsa-miR-494	CLIP-seq
MIRT2505342	hsa-miR-495	CLIP-seq
MIRT2505343	hsa-miR-519a	CLIP-seq
MIRT2505344	hsa-miR-519b-3p	CLIP-seq
MIRT2505345	hsa-miR-519c-3p	CLIP-seq
MIRT2505346	hsa-miR-522	CLIP-seq
MIRT2505347	hsa-miR-576-3p	CLIP-seq
MIRT2505348	hsa-miR-605	CLIP-seq
MIRT898832	hsa-miR-656	CLIP-seq
MIRT2505352	hsa-miR-758	CLIP-seq
MIRT898833	hsa-miR-889	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004550	Function	Nucleoside diphosphate kinase activity	IBA
GO:0004550	Function	Nucleoside diphosphate kinase activity	IDA	23416111
GO:0004550	Function	Nucleoside diphosphate kinase activity	IEA
GO:0004798	Function	DTMP kinase activity	IBA
GO:0004798	Function	DTMP kinase activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	17999954, 36443312
GO:0005739	Component	Mitochondrion	IEA
GO:0006221	Process	Pyrimidine nucleotide biosynthetic process	IEA
GO:0006227	Process	DUDP biosynthetic process	IBA
GO:0006227	Process	DUDP biosynthetic process	IEA
GO:0006233	Process	DTDP biosynthetic process	IBA
GO:0006233	Process	DTDP biosynthetic process	IEA
GO:0006235	Process	DTTP biosynthetic process	IBA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0033862	Function	UMP kinase activity	IDA	17999954
GO:0036430	Function	CMP kinase activity	IEA
GO:0036431	Function	DCMP kinase activity	IEA
GO:0046940	Process	Nucleoside monophosphate phosphorylation	IEA
GO:0050145	Function	Nucleoside monophosphate kinase activity	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA

MIM	HGNC	e!Ensembl
611787	27015	ENSG00000134326

Q5EBM0

Protein name

UMP-CMP kinase 2, mitochondrial (EC 2.7.4.14) (Nucleoside-diphosphate kinase) (EC 2.7.4.6)

Protein function

Mitochondrial nucleotide monophosphate kinase needed for salvage dNTP synthesis that mediates immunomodulatory and antiviral activities through IFN-dependent and IFN-independent pathways (PubMed:17999954, PubMed:30083606, PubMed:36930652, PubMed

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02223	Thymidylate_kin	257 → 438	Thymidylate kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: High levels are observed in myeloid, lymphoid and mesenchymal tissues. {ECO:0000269|PubMed:34142025}.

Sequence

MAFARRLLRGPLSGPLLGRRGVCAGAMAPPRRFVLELPDCTLAHFALGADAPGDADAPDP
RLAALLGPPERSYSLCVPVTPDAGCGARVRAARLHQRLLHQLRRGPFQRCQLLRLLCYCP
GGQAGGAQQGFLLRDPLDDPDTRQALLELLGACQEAPRPHLGEFEADPRGQLWQRLWEVQ
DGRRLQVGCAQVVPVPEPPLHPVVPDLPSSVVFPDREAARAVLEECTSFIPEARAVLDLV
DQCPKQIQKGKFQVVAIEGLDATGKTTVTQSVADSLKAVLLKSPPSCIGQWRKIFDDEPT
IIRRAFYSLGNYIVASEIAKESAKSPVIVDRYWHSTATYAIATEVSGGLQHLPPAHHPVY
QWPEDLLKPDLILLLTVSPEERLQRLQGRGMEKTREEAELEANSVFRQKVEMSYQRMENP
GCHVVDASPSREKVLQTVLSLIQNSFSEP

Sequence length

449

Interactions

View interactions

	KEGG
	Pyrimidine metabolism Metabolic pathways Nucleotide metabolism Biosynthesis of cofactors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BASAL GANGLIA CALCIFICATION, IDIOPATHIC, 10, AUTOSOMAL RECESSIVE	—	ClinVar, GenCC, HPO ClinVar, GenCC, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILATERAL STRIOPALLIDODENTATE CALCINOSIS	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CMPK2-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC BASAL GANGLIA CALCIFICATION 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Atherosclerosis	Associate	33874983	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	19544670, 8104920	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	36862146	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	17052347	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	35958619, 36072597	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fahr's disease	Associate	36862146	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Associate	36143845	★★★★★ ★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	30083606	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	17999954	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Stimulate	17999954	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	17999954	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	33874983	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	10400630	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Disorders	Associate	36862146	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neointima	Associate	33874983	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	12628186, 1311721	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	7479028	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	11121025, 1325827, 20713695, 36143845, 8389529	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17999954	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Associate	35359935, 35958619	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Associate	7576301	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcer	Associate	36143845	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Associate	16537673	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	16537673	★★★★★ ★☆☆☆☆ Found in Text Mining only

CMPK2 (cytidine/uridine monophosphate kinase 2)