Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	129531
Gene name Gene Name - the full gene name approved by the HGNC.	Microtubule interacting and trafficking domain containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MITD1
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q11.2
Summary Summary of gene provided in NCBI Entrez Gene.	Abscission, the separation of daughter cells at the end of cytokinesis, is effected by endosomal sorting complexes required for transport III (ESCRT-III). The protein encoded by this gene functions as a homodimer, with the N-termini binding to a subset of

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048421	hsa-miR-100-5p	CLASH	23622248

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000281	Process	Mitotic cytokinesis	IMP	23045692
GO:0005515	Function	Protein binding	IPI	16730941, 22190034, 23045692, 25416956, 32296183
GO:0005768	Component	Endosome	IEA
GO:0016020	Component	Membrane	IDA	23045692
GO:0016020	Component	Membrane	IEA
GO:0019904	Function	Protein domain specific binding	IPI	23015756
GO:0030496	Component	Midbody	IBA
GO:0030496	Component	Midbody	IDA	23045692
GO:0030496	Component	Midbody	IEA
GO:0030496	Component	Midbody	IMP	23015756
GO:0031902	Component	Late endosome membrane	IEA
GO:0032091	Process	Negative regulation of protein binding	IMP	23015756
GO:0035091	Function	Phosphatidylinositol binding	IMP	23045692
GO:0039702	Process	Viral budding via host ESCRT complex	IMP	23045692
GO:0042802	Function	Identical protein binding	IPI	23015756, 23045692, 32296183
GO:0051301	Process	Cell division	IEA
GO:0061952	Process	Midbody abscission	IBA
GO:0061952	Process	Midbody abscission	IMP	23015756, 23045692
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0071985	Process	Multivesicular body sorting pathway	IMP	23015756, 23045692

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

Q8WV92

Protein name

MIT domain-containing protein 1

Protein function

Required for efficient abscission at the end of cytokinesis, together with components of the ESCRT-III complex.

PDB

2YMB , 4A5X , 4A5Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04212	MIT	13 → 77	MIT (microtubule interacting and transport) domain	Domain
PF16565	MIT_C	100 → 242	Phospholipase D-like domain at C-terminus of MIT	Domain

Sequence

MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCN
LREKISKYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWI
EDPYIRHTHQLYNFLRFCEMLIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSH
GVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDFDLRPCHETTVDI
FHKKHTKNI

Sequence length

249

Interactions

View interactions

MITD1 (microtubule interacting and trafficking domain containing 1)