Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1292
Gene name Gene Name - the full gene name approved by the HGNC.
Collagen type VI alpha 2 chain
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
COL6A2
Synonyms (NCBI Gene) Gene synonyms aliases
BTHLM1, BTHLM1B, PP3610, UCMD1, UCMD1B
Chromosome Chromosome number
21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
21q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of the three alpha chains of type VI collagen, a beaded filament collagen found in most connective tissues. The product of this gene contains several domains similar to von Willebrand Factor type A domains. These domains have been sh
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs35887009 G>A Conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, coding sequence variant, missense variant, non coding transcript variant
rs61735828 G>A,C Likely-benign, uncertain-significance, benign, likely-pathogenic Missense variant, coding sequence variant, non coding transcript variant
rs61735832 G>A Likely-benign, conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, coding sequence variant, synonymous variant, non coding transcript variant
rs61735833 C>T Likely-benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant, non coding transcript variant
rs75581470 C>A Likely-benign, conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022605 hsa-miR-124-3p Microarray 18668037
MIRT047536 hsa-miR-10a-5p CLASH 23622248
MIRT047410 hsa-miR-10b-5p CLASH 23622248
MIRT052889 hsa-miR-3928-3p CLASH 23622248
MIRT054732 hsa-miR-29c-3p Microarray, qRT-PCR 24590289
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 12812986
GO:0005518 Function Collagen binding IEA
GO:0005518 Function Collagen binding IPI 18400749
GO:0005576 Component Extracellular region HDA 27068509
GO:0005576 Component Extracellular region IDA 18400749
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
120240 2212 ENSG00000142173
Protein
UniProt ID P12110
Protein name Collagen alpha-2(VI) chain
Protein function Collagen VI acts as a cell-binding protein.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00092 VWA 46 232 von Willebrand factor type A domain Domain
PF01391 Collagen 254 317 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 301 369 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 409 468 Collagen triple helix repeat (20 copies) Repeat
PF01391 Collagen 531 590 Collagen triple helix repeat (20 copies) Repeat
PF00092 VWA 615 798 von Willebrand factor type A domain Domain
PF00092 VWA 833 1011 von Willebrand factor type A domain Domain
Sequence
MLQGTCSVLLLWGILGAIQAQQQEVISPDTTERNNNCPEKTDCPIHVYFVLDTSESVTMQ
SPTDILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIK
NLQGISSFRRGTFTDCALANMTEQIRQDRSKGTVHFAVVITDGHVTGSPCGGIKLQAERA
REEGIRLFAVAPNQNLKEQGLRDIASTPHELYRNDYATMLPDSTEIDQDTIN
RIIKVMKH
EAYGECYKVSCLEIPGPSGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPK
GVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGNRGPDGYPGEA
GSPGERGDQ
GGKGDPGRPGRRGPPGEIGAKGSKGYQGNSGAPGSPGVKGAKGGPGPRGPK
GEPGRRGDPGTKGSPGSDGPKGEKGDPGPEGPRGLAGEVGNKGAKGDR
GLPGPRGPQGAL
GEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPGFSYPGPRGAPGEKGEPGPRGPEGGRG
DFGLKGEPGRKGEKGEPADPGPPGEPGPRGPRGVPGPEGEPGPPGDPGLT
ECDVMTYVRE
TCGCCDCEKRCGALDVVFVIDSSESIGYTNFTLEKNFVINVVNRLGAIAKDPKSETGTRV
GVVQYSHEGTFEAIQLDDERIDSLSSFKEAVKNLEWIAGGTWTPSALKFAYDRLIKESRR
QKTRVFAVVITDGRHDPRDDDLNLRALCDRDVTVTAIGIGDMFHEKHESENLYSIACDKP
QQVRNMTLFSDLVAEKFI
DDMEDVLCPDPQIVCPDLPCQTELSVAQCTQRPVDIVFLLDG
SERLGEQNFHKARRFVEQVARRLTLARRDDDPLNARVALLQFGGPGEQQVAFPLSHNLTA
IHEALETTQYLNSFSHVGAGVVHAINAIVRSPRGGARRHAELSFVFLTDGVTGNDSLHES
AHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFF
DRFIRWIC
Sequence length 1019
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cytoskeleton in muscle cells
Protein digestion and absorption
Human papillomavirus infection
  Collagen degradation
Collagen biosynthesis and modifying enzymes
Signaling by PDGF
Assembly of collagen fibrils and other multimeric structures
Integrin cell surface interactions
ECM proteoglycans
NCAM1 interactions
Collagen chain trimerization
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Myopathy myopathy rs797045478 N/A
Myosclerosis myosclerosis rs751987553, rs121912942 N/A
Ullrich Congenital Muscular Dystrophy Ullrich congenital muscular dystrophy 1B rs1601231322, rs748035948, rs1568931397, rs267606747, rs387906608, rs398122821, rs749974929 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Bethlem Myopathy Bethlem myopathy 1A N/A N/A GenCC
congenital muscular dystrophy Congenital muscular dystrophy N/A N/A ClinVar
Osteoarthritis Of Hip Osteoarthritis of the hip or knee (with total joint replacement) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atrioventricular Septal Defect Associate 23040494
Bethlem myopathy Associate 10419498, 11707460, 15689448, 19884007, 20302629, 22075033, 22226732, 25533456, 29774307, 33537799, 35026081, 38065855, 39523858, 39596604, 40225172
View all (1 more)
Biliary Atresia Associate 38041174
Brain Neoplasms Associate 20063114
Breast Neoplasms Associate 26474971, 34541602
Carcinoma Renal Cell Associate 35036081
Cerebral Amyloid Angiopathy Associate 29860944, 35778717
Chromosome 21 monosomy Associate 35361402
Chromosome 21 ring Associate 35361402
Collagen Diseases Associate 34167565, 40225934