Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	128869
Gene name Gene Name - the full gene name approved by the HGNC.	Phosphatidylinositol glycan anchor biosynthesis class U
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PIGU
Synonyms (NCBI Gene) Gene synonyms aliases	CDC91L1, GAB1, GPIBD21, NEDBSS, PIG-U
Disease Acronyms (UniProt) Disease acronyms from UniProt database	NEDBSS
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q11.22
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Cdc91, a predicted integral membrane protein that may function in cell division control. The protein encoded by this gene is the fifth subunit of GPI transamidase that attach

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs756912205	G>T	Pathogenic	Coding sequence variant, non coding transcript variant, genic downstream transcript variant, missense variant
rs1600656141	A>T	Pathogenic	Genic upstream transcript variant, non coding transcript variant, coding sequence variant, missense variant

Show/Hide all(28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032423	hsa-let-7b-5p	Proteomics	18668040
MIRT1233593	hsa-miR-1231	CLIP-seq
MIRT1233594	hsa-miR-3120-5p	CLIP-seq
MIRT1233595	hsa-miR-3192	CLIP-seq
MIRT1233596	hsa-miR-3667-3p	CLIP-seq
MIRT1233597	hsa-miR-3689a-3p	CLIP-seq
MIRT1233598	hsa-miR-3689c	CLIP-seq
MIRT1233599	hsa-miR-4279	CLIP-seq
MIRT1233600	hsa-miR-4314	CLIP-seq
MIRT1233601	hsa-miR-4421	CLIP-seq
MIRT1233602	hsa-miR-4646-5p	CLIP-seq
MIRT1233603	hsa-miR-4728-5p	CLIP-seq
MIRT1233604	hsa-miR-942	CLIP-seq
MIRT2295825	hsa-miR-1178	CLIP-seq
MIRT1233593	hsa-miR-1231	CLIP-seq
MIRT1233594	hsa-miR-3120-5p	CLIP-seq
MIRT1233595	hsa-miR-3192	CLIP-seq
MIRT2295826	hsa-miR-3622a-3p	CLIP-seq
MIRT2295827	hsa-miR-3622b-3p	CLIP-seq
MIRT1233596	hsa-miR-3667-3p	CLIP-seq
MIRT1233597	hsa-miR-3689a-3p	CLIP-seq
MIRT1233598	hsa-miR-3689c	CLIP-seq
MIRT1233599	hsa-miR-4279	CLIP-seq
MIRT1233600	hsa-miR-4314	CLIP-seq
MIRT1233601	hsa-miR-4421	CLIP-seq
MIRT1233602	hsa-miR-4646-5p	CLIP-seq
MIRT1233603	hsa-miR-4728-5p	CLIP-seq
MIRT1233604	hsa-miR-942	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IDA	15034568
GO:0006506	Process	GPI anchor biosynthetic process	IDA	15034568
GO:0016020	Component	Membrane	HDA	19946888
GO:0016255	Process	Attachment of GPI anchor to protein	IBA	21873635
GO:0016255	Process	Attachment of GPI anchor to protein	IMP	12802054
GO:0016255	Process	Attachment of GPI anchor to protein	TAS	11483512
GO:0034235	Function	GPI anchor binding	IMP	12802054
GO:0034394	Process	Protein localization to cell surface	IBA	21873635
GO:0042765	Component	GPI-anchor transamidase complex	IBA	21873635
GO:0042765	Component	GPI-anchor transamidase complex	IDA	12802054
GO:0046425	Process	Regulation of receptor signaling pathway via JAK-STAT	IDA	15034568

MIM	HGNC	e!Ensembl
608528	15791	ENSG00000101464

Protein

UniProt ID

Q9H490

Protein name

GPI-anchor transamidase component PIGU (Cell division cycle protein 91-like 1) (Protein CDC91-like 1) (GPI transamidase component PIG-U) (Phosphatidylinositol glycan anchor biosynthesis class U protein)

Protein function

Component of the glycosylphosphatidylinositol-anchor (GPI-anchor) transamidase (GPI-T) complex that catalyzes the formation of the linkage between a proprotein and a GPI-anchor and participates in GPI anchored protein biosynthesis (PubMed:128020

PDB

7W72 , 7WLD , 8IMX , 8IMY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06728	PIG-U	10 → 394		Family

Sequence

MAAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSG
AVFHETPLIIYLFHFLIDYAELVFMITDALTAIALYFAIQDFNKVVFKKQKLLLELDQYA
PDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINNTLIAFFILTTIKGSAF
LSAIFLALATYQSLYPLTLFVPGLLYLLQRQYIPVKMKSKAFWIFSWEYAMMYVGSLVVI
ICLSFFLLSSWDFIPAVYGFILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQINVFFY
TIPLAIKLKEHPIFFMFIQIAVIAIFKSYPTVGDVALYMAFFPVWNHLYRFLRNIFVLTC
IIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQILLISDYFYAFLRREYYLTHGL
YLTAKDGTEAMLVLK

Sequence length

435

Interactions

View interactions

	KEGG		Reactome
	Glycosylphosphatidylinositol (GPI)-anchor biosynthesis Metabolic pathways		Attachment of GPI anchor to uPAR

Show/Hide Causal Diseases (7)

Disease term	Disease name	dbSNP ID	References
Causal
Colonic neoplasms	Malignant tumor of colon	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	30510241
Colorectal cancer	Colorectal Carcinoma, Adenocarcinoma of large intestine	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)	30510241
Colorectal neoplasms	Colorectal Neoplasms, Malignant neoplasm of large intestine	rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049 View all (1682 more)	30510241
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)	31353022
Melanoma	melanoma, Cutaneous Melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	18488026, 28212542, 30429480
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)	31353022
Scoliosis	Scoliosis, unspecified	rs1057518828, rs147296805, rs758163506, rs1555613564, rs1596852902, rs1596853067, rs1596853085	31353022

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Evidence	References	Source
Unknown
Malignant melanoma of skin	Malignant melanoma of skin of lower limb, Malignant melanoma of skin of upper limb		30429480	ClinVar
Nasopharyngeal carcinoma	Nasopharyngeal carcinoma	These data suggest that KAT7 can contribute NPC cell growth and survival through up-regulation of NPC-essential genes.	20512145	ClinVar, CBGDA
Glycosylphosphatidylinositol deficiency	glycosylphosphatidylinositol biosynthesis defect 21			GenCC
Carcinoma	Carcinoma			GWAS
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining
Brain Diseases	Associate	31353022
Breast Neoplasms	Associate	18028549
Carcinoma Hepatocellular	Associate	31277598
Developmental Disabilities	Associate	31353022
Epilepsy	Associate	31353022
Facial Dysmorphism with Multiple Malformations	Associate	31353022
Intellectual Disability	Associate	31353022
Lymphoma	Associate	18487995
Melanoma	Associate	18488026, 23393597
Neoplasms	Associate	21036922
Seizures	Associate	31353022
Skin Neoplasms	Associate	21221757
Squamous Cell Carcinoma of Head and Neck	Associate	18028549
Urinary Bladder Neoplasms	Stimulate	18487995

PIGU (phosphatidylinositol glycan anchor biosynthesis class U)