Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1269
Gene name Gene Name - the full gene name approved by the HGNC.	Cannabinoid receptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CNR2
Synonyms (NCBI Gene) Gene synonyms aliases	CB-2, CB2, CX5
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.	The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-pr

Show/Hide all(46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT901403	hsa-miR-1253	CLIP-seq
MIRT901404	hsa-miR-2964a-5p	CLIP-seq
MIRT901405	hsa-miR-3661	CLIP-seq
MIRT901406	hsa-miR-4764-5p	CLIP-seq
MIRT901407	hsa-miR-619	CLIP-seq
MIRT901408	hsa-miR-631	CLIP-seq
MIRT2447350	hsa-miR-1245b-5p	CLIP-seq
MIRT2447351	hsa-miR-3142	CLIP-seq
MIRT2447352	hsa-miR-3173-3p	CLIP-seq
MIRT2447353	hsa-miR-4695-5p	CLIP-seq
MIRT2447354	hsa-miR-520a-5p	CLIP-seq
MIRT2447355	hsa-miR-525-5p	CLIP-seq
MIRT2447350	hsa-miR-1245b-5p	CLIP-seq
MIRT2447351	hsa-miR-3142	CLIP-seq
MIRT2447352	hsa-miR-3173-3p	CLIP-seq
MIRT2447353	hsa-miR-4695-5p	CLIP-seq
MIRT2447354	hsa-miR-520a-5p	CLIP-seq
MIRT2447355	hsa-miR-525-5p	CLIP-seq

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001975	Process	Response to amphetamine	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004949	Function	Cannabinoid receptor activity	IBA
GO:0004949	Function	Cannabinoid receptor activity	IEA
GO:0004949	Function	Cannabinoid receptor activity	TAS	8679694
GO:0005515	Function	Protein binding	IPI	31616248, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	28364261
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8679694
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	TAS	7556170
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8679694
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030595	Process	Leukocyte chemotaxis	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IEA
GO:0032229	Process	Negative regulation of synaptic transmission, GABAergic	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033004	Process	Negative regulation of mast cell activation	IEA
GO:0038171	Process	Cannabinoid signaling pathway	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045759	Process	Negative regulation of action potential	IEA
GO:0099553	Process	Trans-synaptic signaling by endocannabinoid, modulating synaptic transmission	IEA

MIM	HGNC	e!Ensembl
605051	2160	ENSG00000188822

Protein

UniProt ID

P34972

Protein name

Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5)

Protein function

Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis. {ECO:0000269|PubMed:10051546, E

PDB

2KI9 , 5ZTY , 6KPC , 6KPF , 6PT0 , 8GUQ , 8GUR , 8GUS , 8GUT , 8X3L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	50 → 299	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Preferentially expressed in cells of the immune system with higher expression in B-cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a

Sequence

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Sequence length

360

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Class A/1 (Rhodopsin-like receptors) G alpha (i) signalling events

CNR2 (cannabinoid receptor 2)