Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
126792
Gene name Gene Name - the full gene name approved by the HGNC.
Beta-1,3-galactosyltransferase 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
B3GALT6
Synonyms (NCBI Gene) Gene synonyms aliases
ALGAZ, EDSP2, EDSSPD2, SEMDJL1, beta3GalT6
Disease Acronyms (UniProt) Disease acronyms from UniProt database
ALGAZ, EDSSPD2, SEMDJL1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.33
Summary Summary of gene provided in NCBI Entrez Gene.
The enzyme encoded by this intronless gene is a beta-1,3-galactosyltransferase found in the medial Golgi apparatus, where it catalyzes the transfer of galactose from UDP-galactose to substrates containing a terminal beta-linked galactose moiety. The encod
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT813022 hsa-miR-1271 CLIP-seq
MIRT813023 hsa-miR-129-5p CLIP-seq
MIRT813024 hsa-miR-1343 CLIP-seq
MIRT813025 hsa-miR-141 CLIP-seq
MIRT813026 hsa-miR-1539 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0005794 Component Golgi apparatus IMP 29443383
GO:0005797 Component Golgi medial cisterna IDA 11551958
GO:0006024 Process Glycosaminoglycan biosynthetic process IBA 21873635
GO:0006024 Process Glycosaminoglycan biosynthetic process IMP 11551958
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615291 17978 ENSG00000176022
Protein
UniProt ID Q96L58
Protein name Beta-1,3-galactosyltransferase 6 (Beta-1,3-GalTase 6) (Beta3Gal-T6) (Beta3GalT6) (EC 2.4.1.134) (GAG GalTII) (Galactosyltransferase II) (Galactosylxylosylprotein 3-beta-galactosyltransferase) (UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6)
Protein function Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. Has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01762 Galactosyl_T 71 260 Galactosyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11551958}.
Sequence
MKLLRRAWRRRAALGLGTLALCGAALLYLARCAAEPGDPRAMSGRSPPPPAPARAAAFLA
VLVASAPRAAERRSVIRSTWLARRGAPGDVWARFAVGTAGLGAEERRALEREQARHGDLL
LLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDSFARLDALLAELRAREPARRRR
LYWGFFSGRGRVKPGGRWREAAWQLCDYYLPYALGGGYVLSADLVHYLRLSRDYLRAWHS
EDVSLGAWLAPVDVQREHDP
RFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLC
KREVQLRLSYVYDWSAPPSQCCQRREGIP
Sequence length 329
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Metabolic pathways
  A tetrasaccharide linker sequence is required for GAG synthesis
Defective B3GALT6 causes EDSP2 and SEMDJL1
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Atrial septal defect Atrial Septal Defects rs137852951, rs137852953, rs137852955, rs267607106, rs104893900, rs104893901, rs104893903, rs606231358, rs606231359, rs137852683, rs606231360, rs104893907, rs104894073, rs1585703301, rs104894074
View all (25 more)
Bicuspid aortic valve Bicuspid aortic valve rs1569484234, rs1569484208
Cutis laxa Cutis Laxa rs80356758, rs80356750, rs119489101, rs119489102, rs193302865, rs121918374, rs121918375, rs1598354372, rs1371235353, rs1598358449, rs121918376, rs121918377, rs121918378, rs137854453, rs1797225811
View all (31 more)
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Unknown
Disease term Disease name Evidence References Source
Spondyloepimetaphyseal Dysplasia With Joint Laxity spondyloepimetaphyseal dysplasia with joint laxity, type 1, with or without fractures, spondyloepimetaphyseal dysplasia with joint laxity GenCC
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 30168613
Connective Tissue Diseases Associate 23664117, 23664118
Contracture Associate 23664118
Ehlers Danlos Syndrome Associate 23664117, 23664118, 25331875
Ehlers Danlos syndrome type 3 Associate 28882145, 31614862
Glaucoma Associate 26086840
Growth Disorders Associate 31614862
HEM dysplasia Associate 23664117, 31614862
Intellectual Disability Associate 23664118
Joint Diseases Associate 23664118