Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1266
Gene name Gene Name - the full gene name approved by the HGNC.
Calponin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CNN3
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associ
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003526 hsa-miR-1-3p Luciferase reporter assay 20144220
MIRT004059 hsa-miR-7-5p Microarray 19073608
MIRT019744 hsa-miR-375 Microarray 20215506
MIRT022443 hsa-miR-124-3p Microarray 18668037
MIRT023223 hsa-miR-122-5p Proteomics 21750653
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IEA
GO:0005516 Function Calmodulin binding IEA
GO:0005829 Component Cytosol IDA
GO:0005912 Component Adherens junction HDA 25468996
GO:0005925 Component Focal adhesion HDA 21423176
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602374 2157 ENSG00000117519
Protein
UniProt ID Q15417
Protein name Calponin-3 (Calponin, acidic isoform)
Protein function Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00307 CH 26 131 Calponin homology (CH) domain Domain
PF00402 Calponin 164 188 Calponin family repeat Repeat
PF00402 Calponin 204 228 Calponin family repeat Repeat
PF00402 Calponin 243 267 Calponin family repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in both non-smooth muscle tissues as well as smooth muscle tissues.
Sequence
MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCE
LINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQT
TLVALAGLAKT
KGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMT
AYGTRRHL
YDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN
STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDY
QAEYPDEYHGEYQDDYPRDYQYSDQGIDY
Sequence length 329
Interactions View interactions
<