Gene Gene information from NCBI Gene database.
Entrez ID 1266
Gene name Calponin 3
Gene symbol CNN3
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1p21.3
Summary This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associ
miRNA miRNA information provided by mirtarbase database.
131
miRTarBase ID miRNA Experiments Reference
MIRT003526 hsa-miR-1-3p Luciferase reporter assay 20144220
MIRT004059 hsa-miR-7-5p Microarray 19073608
MIRT019744 hsa-miR-375 Microarray 20215506
MIRT022443 hsa-miR-124-3p Microarray 18668037
MIRT023223 hsa-miR-122-5p Proteomics 21750653
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IEA
GO:0005516 Function Calmodulin binding IEA
GO:0005829 Component Cytosol IDA
GO:0005912 Component Adherens junction HDA 25468996
GO:0005925 Component Focal adhesion HDA 21423176
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602374 2157 ENSG00000117519
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15417
Protein name Calponin-3 (Calponin, acidic isoform)
Protein function Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00307 CH 26 131 Calponin homology (CH) domain Domain
PF00402 Calponin 164 188 Calponin family repeat Repeat
PF00402 Calponin 204 228 Calponin family repeat Repeat
PF00402 Calponin 243 267 Calponin family repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in both non-smooth muscle tissues as well as smooth muscle tissues.
Sequence
MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCE
LINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQT
TLVALAGLAKT
KGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMT
AYGTRRHL
YDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN
STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDY
QAEYPDEYHGEYQDDYPRDYQYSDQGIDY
Sequence length 329
Interactions View interactions