Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1265
Gene name Gene Name - the full gene name approved by the HGNC.
Calponin 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CNN2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Several
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021704 hsa-miR-133a-3p Microarray 21396852
MIRT042725 hsa-miR-346 CLASH 23622248
MIRT037661 hsa-miR-744-5p CLASH 23622248
MIRT479116 hsa-miR-130a-5p PAR-CLIP 23592263
MIRT479115 hsa-miR-23c PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001725 Component Stress fiber IDA 16236705
GO:0003779 Function Actin binding IEA
GO:0005516 Function Calmodulin binding IEA
GO:0005576 Component Extracellular region TAS
GO:0005856 Component Cytoskeleton TAS 8889829
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602373 2156 ENSG00000064666
Protein
UniProt ID Q99439
Protein name Calponin-2 (Calponin H2, smooth muscle) (Neutral calponin)
Protein function Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-A
PDB 1WYN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00307 CH 28 133 Calponin homology (CH) domain Domain
PF00402 Calponin 166 190 Calponin family repeat Repeat
PF00402 Calponin 206 230 Calponin family repeat Repeat
PF00402 Calponin 245 268 Calponin family repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Heart and smooth muscle.
Sequence
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTIL
CTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQV
QVSLLALAGKAKT
KGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSG
MTAYGTRRHL
YDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKC
DNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYP
PYYQEEAGY
Sequence length 309
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neutrophil degranulation
Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Age-related macular degeneration Age related macular degeneration rs199474657, rs61750120, rs1800728, rs62654397, rs61749423, rs61751412, rs61749439, rs61751398, rs61752417, rs62645946, rs1801269, rs62646860, rs61750142, rs61750145, rs61750152
View all (20 more)
26691988
Papillary renal carcinoma Papillary Renal Cell Carcinoma rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724 15108329
Renal carcinoma Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney rs121913668, rs121913670, rs121913243, rs786202724 15108329
Unknown
Disease term Disease name Evidence References Source
Chromophobe carcinoma Chromophobe Renal Cell Carcinoma 15108329 ClinVar
Alzheimer disease Alzheimer disease GWAS
Asthma Asthma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Aortic Aneurysm Abdominal Associate 25993294
Asthma Associate 30426778
Cap Myopathy Associate 23576568
Carcinoma Hepatocellular Associate 37373013
Carcinoma Squamous Cell Associate 36016851
Colorectal Neoplasms Stimulate 37188478
Esophageal Squamous Cell Carcinoma Associate 26330293
Liver Cirrhosis Associate 37373013
Nasopharyngeal Neoplasms Associate 37373013
Neoplasm Metastasis Associate 37188478, 37373013