Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	126393
Gene name	Heat shock protein family B (small) member 6
Gene symbol	HSPB6
Synonyms (NCBI Gene)	HEL55Hsp20PPP1R91
Chromosome	19
Chromosome location	19q13.12
Summary	This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation. [provided by RefSeq, Jan 2012]

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004508	hsa-miR-320a	Luciferase reporter assay	19380620
MIRT572330	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT572329	hsa-miR-29b-1-5p	PAR-CLIP	20371350
MIRT572328	hsa-miR-3120-5p	PAR-CLIP	20371350
MIRT572327	hsa-miR-6132	PAR-CLIP	20371350
MIRT572326	hsa-miR-6836-5p	PAR-CLIP	20371350
MIRT572325	hsa-miR-1909-3p	PAR-CLIP	20371350
MIRT572324	hsa-miR-6722-3p	PAR-CLIP	20371350
MIRT572323	hsa-miR-4533	PAR-CLIP	20371350
MIRT572322	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT572320	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT572321	hsa-miR-4271	PAR-CLIP	20371350
MIRT572319	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT572318	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT572317	hsa-miR-656-5p	PAR-CLIP	20371350
MIRT572316	hsa-miR-6511b-5p	PAR-CLIP	20371350
MIRT572315	hsa-miR-6811-5p	PAR-CLIP	20371350
MIRT572314	hsa-miR-1231	PAR-CLIP	20371350
MIRT572330	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT572329	hsa-miR-29b-1-5p	PAR-CLIP	20371350
MIRT572328	hsa-miR-3120-5p	PAR-CLIP	20371350
MIRT572327	hsa-miR-6132	PAR-CLIP	20371350
MIRT572326	hsa-miR-6836-5p	PAR-CLIP	20371350
MIRT572325	hsa-miR-1909-3p	PAR-CLIP	20371350
MIRT572324	hsa-miR-6722-3p	PAR-CLIP	20371350
MIRT572323	hsa-miR-4533	PAR-CLIP	20371350
MIRT572322	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT572320	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT572321	hsa-miR-4271	PAR-CLIP	20371350
MIRT572319	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT572318	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT572317	hsa-miR-656-5p	PAR-CLIP	20371350
MIRT572316	hsa-miR-6511b-5p	PAR-CLIP	20371350
MIRT572315	hsa-miR-6811-5p	PAR-CLIP	20371350
MIRT572314	hsa-miR-1231	PAR-CLIP	20371350
MIRT1056406	hsa-miR-1252	CLIP-seq
MIRT1056407	hsa-miR-1253	CLIP-seq
MIRT1056408	hsa-miR-1587	CLIP-seq
MIRT1056409	hsa-miR-3135b	CLIP-seq
MIRT1056410	hsa-miR-3652	CLIP-seq
MIRT1056411	hsa-miR-3689a-3p	CLIP-seq
MIRT1056412	hsa-miR-3689c	CLIP-seq
MIRT1056413	hsa-miR-3689d	CLIP-seq
MIRT1056414	hsa-miR-3940-5p	CLIP-seq
MIRT1056415	hsa-miR-4428	CLIP-seq
MIRT1056416	hsa-miR-4430	CLIP-seq
MIRT1056417	hsa-miR-4434	CLIP-seq
MIRT1056418	hsa-miR-4492	CLIP-seq
MIRT1056419	hsa-miR-4498	CLIP-seq
MIRT1056420	hsa-miR-4507	CLIP-seq
MIRT1056421	hsa-miR-4516	CLIP-seq
MIRT1056422	hsa-miR-4656	CLIP-seq
MIRT1056423	hsa-miR-4675	CLIP-seq
MIRT1056424	hsa-miR-4728-5p	CLIP-seq
MIRT1056425	hsa-miR-4741	CLIP-seq
MIRT1056426	hsa-miR-4779	CLIP-seq
MIRT1056427	hsa-miR-486-3p	CLIP-seq
MIRT1056428	hsa-miR-762	CLIP-seq
MIRT1056429	hsa-miR-765	CLIP-seq
MIRT1549651	hsa-miR-3126-3p	CLIP-seq
MIRT1056424	hsa-miR-4728-5p	CLIP-seq
MIRT2012966	hsa-miR-1909	CLIP-seq
MIRT2012967	hsa-miR-4481	CLIP-seq
MIRT2012968	hsa-miR-4745-5p	CLIP-seq
MIRT2012966	hsa-miR-1909	CLIP-seq
MIRT1056410	hsa-miR-3652	CLIP-seq
MIRT1056416	hsa-miR-4430	CLIP-seq
MIRT2451438	hsa-miR-1275	CLIP-seq
MIRT2451439	hsa-miR-193a-3p	CLIP-seq
MIRT2451440	hsa-miR-193b	CLIP-seq
MIRT2451441	hsa-miR-3170	CLIP-seq
MIRT2451442	hsa-miR-3176	CLIP-seq
MIRT2451443	hsa-miR-3922-3p	CLIP-seq
MIRT2451444	hsa-miR-4525	CLIP-seq
MIRT2451445	hsa-miR-4665-5p	CLIP-seq
MIRT2451446	hsa-miR-4723-5p	CLIP-seq
MIRT1056424	hsa-miR-4728-5p	CLIP-seq
MIRT2451447	hsa-miR-625	CLIP-seq
MIRT2451448	hsa-miR-661	CLIP-seq
MIRT2548406	hsa-miR-2467-5p	CLIP-seq
MIRT2548407	hsa-miR-3150b-3p	CLIP-seq
MIRT2548408	hsa-miR-342-5p	CLIP-seq
MIRT2548409	hsa-miR-4293	CLIP-seq
MIRT2548410	hsa-miR-4466	CLIP-seq
MIRT2548411	hsa-miR-4532	CLIP-seq
MIRT2548412	hsa-miR-4664-5p	CLIP-seq
MIRT2548413	hsa-miR-4689	CLIP-seq
MIRT2548414	hsa-miR-4695-5p	CLIP-seq
MIRT2548415	hsa-miR-4784	CLIP-seq
MIRT2548416	hsa-miR-544b	CLIP-seq
MIRT2548417	hsa-miR-675	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005212	Function	Structural constituent of eye lens	IEA
GO:0005576	Component	Extracellular region	IDA	22427880
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19464326
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19464326
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006457	Process	Protein folding	IDA	14717697
GO:0009408	Process	Response to heat	IBA
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0019901	Function	Protein kinase binding	IEA
GO:0042026	Process	Protein refolding	IBA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0044183	Function	Protein folding chaperone	IDA	24382496
GO:0045766	Process	Positive regulation of angiogenesis	IDA	22427880
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IDA	19845507
GO:0051087	Function	Protein-folding chaperone binding	IPI	23948568

MIM	HGNC	e!Ensembl
610695	26511	ENSG00000004776

O14558

Protein name

Heat shock protein beta-6 (HspB6) (Heat shock 20 kDa-like protein p20) (Heat shock protein family B member 6)

Protein function

Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Seems to have versatile functions in various biological processes. Plays a role in regulating muscle function

PDB

4JUS , 4JUT , 5LTW , 5LU1 , 5LU2 , 5LUM , 5OK9 , 5OKF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00525	Crystallin	3 → 62	Alpha crystallin A chain, N terminal	Family
PF00011	HSP20	66 → 158	Hsp20/alpha crystallin family	Family

Sequence

MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSV
ALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRR
YRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK

Sequence length

160

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	rs2513434472	RCV004560316

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
AA amyloidosis	Associate	24859569
Alzheimer Disease	Associate	24859569
Breast Neoplasms	Associate	35132081
Carcinoma Hepatocellular	Associate	17487383, 24223153, 27046040, 28456666
Cardiomegaly	Associate	38172650
Cardiomyopathies	Associate	36918127
Chronic Pain	Associate	27832094
Demyelinating Diseases	Associate	26694816
Esophageal Squamous Cell Carcinoma	Associate	29301256
Genetic Diseases Inborn	Associate	25965061
Heart Diseases	Associate	21545686
Heart Failure	Associate	21545686
Hyperplasia	Inhibit	15218470
Lung Neoplasms	Associate	30286088
Multiple Sclerosis	Stimulate	26694816
Multiple Sclerosis	Associate	30014472
Neoplasms	Inhibit	17487383
Neoplasms	Associate	25798051, 30286088, 36299463
Neoplastic Syndromes Hereditary	Associate	25965061
Nerve Degeneration	Associate	24859569
Neurotoxicity Syndromes	Inhibit	24859569
Spinal Cord Diseases	Associate	30014472
Urethral Neoplasms	Associate	33200223
Urinary Bladder Neoplasms	Associate	34930465
Uterine Cervical Neoplasms	Associate	39372720
Vasospasm Intracranial	Inhibit	15829720

HSPB6 (heat shock protein family B (small) member 6)