Gene Gene information from NCBI Gene database.
Entrez ID 126364
Gene name Leucine rich repeat containing 25
Gene symbol LRRC25
Synonyms (NCBI Gene)
MAPA
Chromosome 19
Chromosome location 19p13.11
miRNA miRNA information provided by mirtarbase database.
214
miRTarBase ID miRNA Experiments Reference
MIRT1119204 hsa-miR-103a CLIP-seq
MIRT1119205 hsa-miR-107 CLIP-seq
MIRT1119206 hsa-miR-1254 CLIP-seq
MIRT1119207 hsa-miR-1270 CLIP-seq
MIRT1119208 hsa-miR-1827 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21044950, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005783 Component Endoplasmic reticulum IDA
GO:0005829 Component Cytosol IDA
GO:0015630 Component Microtubule cytoskeleton IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607518 29806 ENSG00000175489
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N386
Protein name Leucine-rich repeat-containing protein 25 (Monocyte and plasmacytoid-activated protein)
Protein function Plays a role in the inhibition of RLR-mediated type I interferon signaling pathway by targeting RIGI for autophagic degradation. Interacts specifically with ISG15-associated RIGI to promote interaction between RIGI and the autophagic cargo recep
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in plasmacytoid dendritic cells (PDC), monocyte-derived dendritic cells (MDDC), granulocytes, monocytes, B-lymphocytes, peripheral blood leukocytes, spleen, bone marrow, and, to a lesser extent, lymph nodes, fetal liver, and
Sequence
MGGTLAWTLLLPLLLRESDSLEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRA
SNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCAL
ESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATIGAVVVSGCLLLGLA
IAGPVLAWRLWRCRVARSRELNKPWAAQDGPKPGLGLQPRYGSRSAPKPQVAVPSCPSTP
DYENMFVGQPAAEHQWDEQGAHPSEDNDFYINYKDIDLASQPVYCNLQSLGQAPMDEEEY
VIPGH
Sequence length 305
Interactions View interactions