Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	126326
Gene name Gene Name - the full gene name approved by the HGNC.	GIPC PDZ domain containing family member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GIPC3
Synonyms (NCBI Gene) Gene synonyms aliases	C19orf64, DFNB15, DFNB72, DFNB95
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the GIPC family. Studies in mice suggest that this gene is required for postnatal maturation of the hair bundle and long-term survival of hair cells and spiral ganglion in the ear. Mutations in this gene are ass

Show/Hide all(14)

SNP ID	Visualize variation	Clinical significance	Consequence
rs138339125	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs387906999	T>G	Pathogenic	Coding sequence variant, missense variant
rs387907000	G>A	Pathogenic	Stop gained, coding sequence variant, missense variant
rs387907001	G>A	Pathogenic	Coding sequence variant, missense variant
rs387907002	C>A,T	Pathogenic	Coding sequence variant, missense variant
rs727503062	C>A	Likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs727504771	GGGTCAGATAGGCCTGG>-	Pathogenic	Frameshift variant, coding sequence variant
rs748150647	G>-,GG	Pathogenic	Frameshift variant, coding sequence variant
rs764467903	G>A	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs876657692	G>A	Pathogenic	Splice donor variant
rs946085339	G>A,T	Pathogenic	Missense variant, coding sequence variant
rs1348505504	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1466835034	T>C	Likely-pathogenic	Coding sequence variant, missense variant, stop lost, terminator codon variant
rs1568278651	G>T	Pathogenic	Coding sequence variant, stop gained

Show/Hide all(115)

miRTarBase ID	miRNA	Experiments	Reference
MIRT755465	hsa-miR-762	qRT-PCR	36301034
MIRT1019434	hsa-miR-1914	CLIP-seq
MIRT1019435	hsa-miR-197	CLIP-seq
MIRT1019436	hsa-miR-3160-3p	CLIP-seq
MIRT1019437	hsa-miR-4487	CLIP-seq
MIRT1019438	hsa-miR-4786-3p	CLIP-seq
MIRT1019439	hsa-miR-5096	CLIP-seq
MIRT1019440	hsa-miR-558	CLIP-seq
MIRT1549212	hsa-miR-1207-3p	CLIP-seq
MIRT2001882	hsa-miR-193a-5p	CLIP-seq
MIRT2001883	hsa-miR-198	CLIP-seq
MIRT1019436	hsa-miR-3160-3p	CLIP-seq
MIRT2001884	hsa-miR-3180-5p	CLIP-seq
MIRT2001885	hsa-miR-378g	CLIP-seq
MIRT1019437	hsa-miR-4487	CLIP-seq
MIRT2001886	hsa-miR-4492	CLIP-seq
MIRT2001887	hsa-miR-4498	CLIP-seq
MIRT2001888	hsa-miR-4505	CLIP-seq
MIRT2001889	hsa-miR-4633-3p	CLIP-seq
MIRT2001890	hsa-miR-4674	CLIP-seq
MIRT2001891	hsa-miR-4682	CLIP-seq
MIRT2001892	hsa-miR-4731-5p	CLIP-seq
MIRT2001893	hsa-miR-516b	CLIP-seq
MIRT2001894	hsa-miR-520a-5p	CLIP-seq
MIRT2001895	hsa-miR-525-5p	CLIP-seq
MIRT1019440	hsa-miR-558	CLIP-seq
MIRT755465	hsa-miR-762	CLIP-seq
MIRT2234921	hsa-miR-1205	CLIP-seq
MIRT2234922	hsa-miR-1207-5p	CLIP-seq
MIRT2234923	hsa-miR-1269	CLIP-seq
MIRT2234924	hsa-miR-1269b	CLIP-seq
MIRT2234925	hsa-miR-1286	CLIP-seq
MIRT2234926	hsa-miR-1287	CLIP-seq
MIRT2234927	hsa-miR-1288	CLIP-seq
MIRT2234928	hsa-miR-1299	CLIP-seq
MIRT2234929	hsa-miR-1587	CLIP-seq
MIRT2234930	hsa-miR-1909	CLIP-seq
MIRT1019434	hsa-miR-1914	CLIP-seq
MIRT2001882	hsa-miR-193a-5p	CLIP-seq
MIRT2234931	hsa-miR-2115	CLIP-seq
MIRT2234932	hsa-miR-2392	CLIP-seq
MIRT2234933	hsa-miR-24	CLIP-seq
MIRT2234934	hsa-miR-3135b	CLIP-seq
MIRT2001884	hsa-miR-3180-5p	CLIP-seq
MIRT2234935	hsa-miR-3194-3p	CLIP-seq
MIRT2234936	hsa-miR-378	CLIP-seq
MIRT2234937	hsa-miR-378b	CLIP-seq
MIRT2234938	hsa-miR-378c	CLIP-seq
MIRT2234939	hsa-miR-378d	CLIP-seq
MIRT2234940	hsa-miR-378e	CLIP-seq
MIRT2234941	hsa-miR-378f	CLIP-seq
MIRT2001885	hsa-miR-378g	CLIP-seq
MIRT2234942	hsa-miR-378h	CLIP-seq
MIRT2234943	hsa-miR-378i	CLIP-seq
MIRT2234944	hsa-miR-3918	CLIP-seq
MIRT2234945	hsa-miR-3977	CLIP-seq
MIRT2234946	hsa-miR-422a	CLIP-seq
MIRT2234947	hsa-miR-431	CLIP-seq
MIRT2234948	hsa-miR-4320	CLIP-seq
MIRT2234949	hsa-miR-4426	CLIP-seq
MIRT2234950	hsa-miR-4437	CLIP-seq
MIRT1019437	hsa-miR-4487	CLIP-seq
MIRT2001886	hsa-miR-4492	CLIP-seq
MIRT2001887	hsa-miR-4498	CLIP-seq
MIRT2234951	hsa-miR-4515	CLIP-seq
MIRT2001889	hsa-miR-4633-3p	CLIP-seq
MIRT2234952	hsa-miR-4647	CLIP-seq
MIRT2234953	hsa-miR-4656	CLIP-seq
MIRT2234954	hsa-miR-4662b	CLIP-seq
MIRT2001890	hsa-miR-4674	CLIP-seq
MIRT2234955	hsa-miR-4675	CLIP-seq
MIRT2001891	hsa-miR-4682	CLIP-seq
MIRT2234956	hsa-miR-4722-5p	CLIP-seq
MIRT2234957	hsa-miR-4740-5p	CLIP-seq
MIRT2234958	hsa-miR-4741	CLIP-seq
MIRT2234959	hsa-miR-4763-3p	CLIP-seq
MIRT2234960	hsa-miR-4782-5p	CLIP-seq
MIRT2234961	hsa-miR-486-3p	CLIP-seq
MIRT2234962	hsa-miR-516a-3p	CLIP-seq
MIRT2001893	hsa-miR-516b	CLIP-seq
MIRT2001894	hsa-miR-520a-5p	CLIP-seq
MIRT2001895	hsa-miR-525-5p	CLIP-seq
MIRT2234963	hsa-miR-526b	CLIP-seq
MIRT755465	hsa-miR-762	CLIP-seq
MIRT2388458	hsa-miR-3187-3p	CLIP-seq
MIRT2388459	hsa-miR-3670	CLIP-seq
MIRT2388460	hsa-miR-4435	CLIP-seq
MIRT2388461	hsa-miR-4453	CLIP-seq
MIRT1019437	hsa-miR-4487	CLIP-seq
MIRT2388462	hsa-miR-4538	CLIP-seq
MIRT2001889	hsa-miR-4633-3p	CLIP-seq
MIRT2234953	hsa-miR-4656	CLIP-seq
MIRT2388463	hsa-miR-4667-5p	CLIP-seq
MIRT2234955	hsa-miR-4675	CLIP-seq
MIRT2388464	hsa-miR-4700-5p	CLIP-seq
MIRT2388465	hsa-miR-4701-5p	CLIP-seq
MIRT2234958	hsa-miR-4741	CLIP-seq
MIRT2388466	hsa-miR-4755-3p	CLIP-seq
MIRT2001893	hsa-miR-516b	CLIP-seq
MIRT2388467	hsa-miR-548s	CLIP-seq
MIRT2388468	hsa-miR-588	CLIP-seq
MIRT2388469	hsa-miR-637	CLIP-seq
MIRT1019434	hsa-miR-1914	CLIP-seq
MIRT1019436	hsa-miR-3160-3p	CLIP-seq
MIRT1019437	hsa-miR-4487	CLIP-seq
MIRT1019440	hsa-miR-558	CLIP-seq
MIRT2234926	hsa-miR-1287	CLIP-seq
MIRT2234934	hsa-miR-3135b	CLIP-seq
MIRT1019437	hsa-miR-4487	CLIP-seq
MIRT2001889	hsa-miR-4633-3p	CLIP-seq
MIRT1019434	hsa-miR-1914	CLIP-seq
MIRT1019434	hsa-miR-1914	CLIP-seq
MIRT1019436	hsa-miR-3160-3p	CLIP-seq
MIRT1019437	hsa-miR-4487	CLIP-seq
MIRT1019440	hsa-miR-558	CLIP-seq

Show/Hide all(1)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183

MIM	HGNC	e!Ensembl
608792	18183	ENSG00000179855

Protein

UniProt ID

Q8TF64

Protein name

PDZ domain-containing protein GIPC3

Protein function

Required for postnatal maturation of the hair bundle and long-term survival of hair cells and spiral ganglion.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00595	PDZ	112 → 191	PDZ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in adult and fetal tissues. Highest levels are found in jejunum, lymph node, parietal lobe, fetal spleen and fetal thymus. Expressed in cervical, melanoma, chronic myelogenous and gastric cancer cell lines. {ECO:000026

Sequence

MEGAAAREARGTETPRASAPPPAPSEPPAAPRARPRLVFRTQLAHGSPTGKIEGFTNVRE
LYAKIAEAFGIAPTEILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTED
ALGLTITDNGAGYAFIKRIKEGSIINRIEAVCVGDSIEAINDHSIVGCRHYEVAKMLREL
PKSQPFTLRLVQPKRAFDMIGQRSRSSKCPVEAKVTSGRETLRLRSGGAATVEEAPSEFE
EEASRKVDDLLESYMGIRDPELASTMVETSKKTASAQEFARCLDSVLGEFAFPDEFVVEV
WAAIGEAREACG

Sequence length

312

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Deafness	Autosomal recessive nonsyndromic hearing loss 15	rs727503062, rs1568278651, rs387906999, rs387907000, rs748150647, rs387907001, rs946085339, rs387907002	N/A
Hearing Loss	Hearing loss, autosomal recessive	rs761543680	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
hearing impairment	Hearing impairment	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Deafness	Associate	23226338, 33168789
Erythrocytosis Familial 2	Associate	34071867
Hearing Loss	Associate	21660509, 22363784, 32682410, 32864763, 32991204
Hearing Loss Sensorineural	Associate	34071867
Lupus Vasculitis Central Nervous System	Associate	36301034
Nonsyndromic Deafness	Associate	21660509, 23226338, 31389194, 32864763
Nonsyndromic sensorineural hearing loss	Associate	22363784, 34071867
Osteoporosis	Associate	21660509

GIPC3 (GIPC PDZ domain containing family member 3)