Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
126326
Gene name Gene Name - the full gene name approved by the HGNC.
GIPC PDZ domain containing family member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GIPC3
Synonyms (NCBI Gene) Gene synonyms aliases
C19orf64, DFNB15, DFNB72, DFNB95
Disease Acronyms (UniProt) Disease acronyms from UniProt database
DFNB15
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the GIPC family. Studies in mice suggest that this gene is required for postnatal maturation of the hair bundle and long-term survival of hair cells and spiral ganglion in the ear. Mutations in this gene are ass
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs138339125 G>A Conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs387906999 T>G Pathogenic Coding sequence variant, missense variant
rs387907000 G>A Pathogenic Stop gained, coding sequence variant, missense variant
rs387907001 G>A Pathogenic Coding sequence variant, missense variant
rs387907002 C>A,T Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT755465 hsa-miR-762 qRT-PCR 36301034
MIRT1019434 hsa-miR-1914 CLIP-seq
MIRT1019435 hsa-miR-197 CLIP-seq
MIRT1019436 hsa-miR-3160-3p CLIP-seq
MIRT1019437 hsa-miR-4487 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608792 18183 ENSG00000179855
Protein
UniProt ID Q8TF64
Protein name PDZ domain-containing protein GIPC3
Protein function Required for postnatal maturation of the hair bundle and long-term survival of hair cells and spiral ganglion.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00595 PDZ 112 191 PDZ domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed in adult and fetal tissues. Highest levels are found in jejunum, lymph node, parietal lobe, fetal spleen and fetal thymus. Expressed in cervical, melanoma, chronic myelogenous and gastric cancer cell lines. {ECO:000026
Sequence
MEGAAAREARGTETPRASAPPPAPSEPPAAPRARPRLVFRTQLAHGSPTGKIEGFTNVRE
LYAKIAEAFGIAPTEILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTED
ALGLTITDNGAGYAFIKRIKEGSIINRIEAVCVGDSIEAINDHSIVGCRHYEVAKMLREL
PKSQPFTLRLV
QPKRAFDMIGQRSRSSKCPVEAKVTSGRETLRLRSGGAATVEEAPSEFE
EEASRKVDDLLESYMGIRDPELASTMVETSKKTASAQEFARCLDSVLGEFAFPDEFVVEV
WAAIGEAREACG
Sequence length 312
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Deafness DEAFNESS, AUTOSOMAL RECESSIVE 15 rs267607135, rs387906219, rs387906220, rs387906221, rs387906222, rs606231120, rs267606855, rs121918370, rs137853185, rs137853186, rs137853187, rs137853188, rs587776522, rs587776523, rs200781822
View all (1019 more)
21660509, 9286457, 21326233
Hearing loss Sensorineural Hearing Loss (disorder) rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359
View all (184 more)
Nonsyndromic deafness Nonsyndromic Deafness rs606231410, rs794729665, rs730880338, rs1566538321 21326233, 21660509
Unknown
Disease term Disease name Evidence References Source
Alzheimer disease Alzheimer disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Deafness Associate 23226338, 33168789
Erythrocytosis Familial 2 Associate 34071867
Hearing Loss Associate 21660509, 22363784, 32682410, 32864763, 32991204
Hearing Loss Sensorineural Associate 34071867
Lupus Vasculitis Central Nervous System Associate 36301034
Nonsyndromic Deafness Associate 21660509, 23226338, 31389194, 32864763
Nonsyndromic sensorineural hearing loss Associate 22363784, 34071867
Osteoporosis Associate 21660509