JSRP1 (junctional sarcoplasmic reticulum protein 1)

Gene
Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
126306
Gene name Gene Name - the full gene name approved by the HGNC.
Junctional sarcoplasmic reticulum protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
JSRP1
Synonyms (NCBI Gene) Gene synonyms aliases
JP-45, JP45
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is involved in excitation-contraction coupling at the sarcoplasmic reticulum. The encoded protein can interact with CACNA1S, CACNB1, and calsequestrin to help regulate calcium influx and efflux in skeletal muscle. [provide
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(16)
miRTarBase ID miRNA Experiments Reference
MIRT1077969 hsa-miR-198 CLIP-seq
MIRT1077970 hsa-miR-296-5p CLIP-seq
MIRT1077971 hsa-miR-3154 CLIP-seq
MIRT1077972 hsa-miR-3179 CLIP-seq
MIRT1077973 hsa-miR-331-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0003009 Process Skeletal muscle contraction IBA 21873635
GO:0003009 Process Skeletal muscle contraction IDA 22927026
GO:0005515 Function Protein binding IPI 32296183
GO:0016529 Component Sarcoplasmic reticulum IBA 21873635
GO:0033017 Component Sarcoplasmic reticulum membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
608743 24963 ENSG00000167476
Protein
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Q96MG2
Protein name Junctional sarcoplasmic reticulum protein 1 (Junctional-face membrane protein of 45 kDa homolog) (JP-45)
Protein function Involved in skeletal muscle excitation/contraction coupling (EC), probably acting as a regulator of the voltage-sensitive calcium channel CACNA1S. EC is a physiological process whereby an electrical signal (depolarization of the plasma membrane)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15312 JSRP 115 → 177 Junctional sarcoplasmic reticulum protein Family
Sequence 
MSMTTRAWEELDGGLGSCQALEDHSALAETQEDRASATPRLADSGSVPHDSQVAEGPSVD
TRPKKMEKEPAARGTPGTGKERLKAGASPRSVPARKKAQTAPPLQPPPPPPALSEELPWG
DLSLNKCLVLASLVALLGSAFQLCRDAVPGEAALQARVPEPWVPPSSAPREPSSPLPKFE
AQAPPSAPPAPRAEAEVRPKIPGSREAAENDEEEPGEATGEAVREDRVTLADRGPKERPR
REGKPRKEKPRKEERPKKERPRKEERPRAAREPREALPQRWESREGGHRPWARDSRDAEP
RKKQAWVSPRRPDEEQRPGSRQKLRAGKGRD
Sequence length 331
Interactions View interactions