JSRP1 (junctional sarcoplasmic reticulum protein 1)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 126306
Gene name Junctional sarcoplasmic reticulum protein 1
Gene symbol JSRP1
Synonyms (NCBI Gene)
JP-45JP45
Chromosome 19
Chromosome location 19p13.3
Summary The protein encoded by this gene is involved in excitation-contraction coupling at the sarcoplasmic reticulum. The encoded protein can interact with CACNA1S, CACNB1, and calsequestrin to help regulate calcium influx and efflux in skeletal muscle. [provide
miRNA miRNA information provided by mirtarbase database.
16
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (16)
miRTarBase ID miRNA Experiments Reference
MIRT1077969 hsa-miR-198 CLIP-seq
MIRT1077970 hsa-miR-296-5p CLIP-seq
MIRT1077971 hsa-miR-3154 CLIP-seq
MIRT1077972 hsa-miR-3179 CLIP-seq
MIRT1077973 hsa-miR-331-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (9)
GO ID Ontology Definition Evidence Reference
GO:0003009 Process Skeletal muscle contraction IBA
GO:0003009 Process Skeletal muscle contraction IDA 22927026
GO:0005515 Function Protein binding IPI 32296183
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
608743 24963 ENSG00000167476
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96MG2
Protein name Junctional sarcoplasmic reticulum protein 1 (Junctional-face membrane protein of 45 kDa homolog) (JP-45)
Protein function Involved in skeletal muscle excitation/contraction coupling (EC), probably acting as a regulator of the voltage-sensitive calcium channel CACNA1S. EC is a physiological process whereby an electrical signal (depolarization of the plasma membrane)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15312 JSRP 115 → 177 Junctional sarcoplasmic reticulum protein Family
Sequence 
MSMTTRAWEELDGGLGSCQALEDHSALAETQEDRASATPRLADSGSVPHDSQVAEGPSVD
TRPKKMEKEPAARGTPGTGKERLKAGASPRSVPARKKAQTAPPLQPPPPPPALSEELPWG
DLSLNKCLVLASLVALLGSAFQLCRDAVPGEAALQARVPEPWVPPSSAPREPSSPLPKFE
AQAPPSAPPAPRAEAEVRPKIPGSREAAENDEEEPGEATGEAVREDRVTLADRGPKERPR
REGKPRKEKPRKEERPKKERPRKEERPRAAREPREALPQRWESREGGHRPWARDSRDAEP
RKKQAWVSPRRPDEEQRPGSRQKLRAGKGRD
Sequence length 331
Interactions View interactions