ZNF57 (zinc finger protein 57)

Gene

• Entrez ID: 126295
• Gene name: Zinc finger protein 57
• Gene symbol: ZNF57
• Synonyms (NCBI Gene): ZNF424
• Chromosome: 19
• Chromosome location: 19p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1530225	hsa-let-7a	CLIP-seq
MIRT1530226	hsa-let-7b	CLIP-seq
MIRT1530227	hsa-let-7c	CLIP-seq
MIRT1530228	hsa-let-7d	CLIP-seq
MIRT1530229	hsa-let-7e	CLIP-seq
MIRT1530230	hsa-let-7f	CLIP-seq
MIRT1530231	hsa-let-7g	CLIP-seq
MIRT1530232	hsa-let-7i	CLIP-seq
MIRT1530233	hsa-miR-193a-5p	CLIP-seq
MIRT1530234	hsa-miR-202	CLIP-seq
MIRT1530235	hsa-miR-338-5p	CLIP-seq
MIRT1530236	hsa-miR-4458	CLIP-seq
MIRT1530237	hsa-miR-4487	CLIP-seq
MIRT1530238	hsa-miR-4500	CLIP-seq
MIRT1530239	hsa-miR-4506	CLIP-seq
MIRT1530240	hsa-miR-4678	CLIP-seq
MIRT1530241	hsa-miR-487a	CLIP-seq
MIRT1530242	hsa-miR-520d-5p	CLIP-seq
MIRT1530243	hsa-miR-524-5p	CLIP-seq
MIRT1530244	hsa-miR-875-3p	CLIP-seq
MIRT1530245	hsa-miR-98	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q68EA5
• Protein name: Zinc finger protein 57 (Zinc finger protein 424)
• Protein function: May be involved in transcriptional regulation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01352	KRAB	3 → 44	KRAB box	Family
  PF00096	zf-C2H2	140 → 162	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	252 → 274	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	280 → 302	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	308 → 330	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	336 → 358	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	364 → 386	Zinc finger, C2H2 type	Domain
  PF13894	zf-C2H2_4	392 → 415		Domain
  PF00096	zf-C2H2	420 → 442	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	448 → 470	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	476 → 498	Zinc finger, C2H2 type	Domain

• Sequence:

  MDSVVFEDVAVDFTLEEWALLDSAQRDLYRDVMLETFRNLASVDDGTQFKANGSVSLQDM
  YGQEKSKEQTIPNFTGNNSCAYTLEKNCEGYGTEDHHKNLRNHMVDRFCTHNEGNQYGEA
  IHQMPDLTLHKKVSAGEKPYECTKCRTVFTHLSSLKRHVKSHCGRKAPPGEECKQACICP
  SHLHSHGRTDTEEKPYKCQACGQTFQHPRYLSHHVKTHTAEKTYKCEQCRMAFNGFASFT
  RHVRTHTKDRPYKCQECGRAFIYPSTFQRHMTTHTGEKPYKCQHCGKAFTYPQAFQRHEK
  THTGEKPYECKQCGKTFSWSETLRVHMRIHTGDKLYKCEHCGKAFTSSRSFQGHLRTHTG
  EKPYECKQCGKAFTWSSTFREHVRIHTQEQLYKCEQCGKAFTSSRSFRGHLRTHTGEKPY
  ECKQCGKTFTWSSTFREHVRIHTQEQLHKCEHCGKAFTSSRAFQGHLRMHTGEKPYECKQ
  CGKTFTWSSTLHNHVRMHTGEKPHKCKQCGMSFKWHSSFRNHLRMHTGQKSHECQSYSKA
  FSCQVILSKTSESTH

• Sequence length: 555

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER'S DISEASE NEUROPATHOLOGIC CHANGE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Carcinogenesis	Associate	29974829	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Associate	22363784	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Inhibit	29974829	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	29974829	★☆☆☆☆ Found in Text Mining only
Periodontitis	Associate	27302879	★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Associate	28406917	★☆☆☆☆ Found in Text Mining only