Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	125997
Gene name Gene Name - the full gene name approved by the HGNC.	Methyl-CpG binding domain protein 3 like 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MBD3L2
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein has been found in germ cell tumors and some somatic tissues. [provided by RefSeq, Jul 2008]

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments
MIRT1135029	hsa-miR-2110	CLIP-seq
MIRT1135030	hsa-miR-3202	CLIP-seq
MIRT1135031	hsa-miR-4271	CLIP-seq
MIRT1135032	hsa-miR-4456	CLIP-seq
MIRT1135033	hsa-miR-4668-5p	CLIP-seq
MIRT1135034	hsa-miR-4725-3p	CLIP-seq
MIRT1135035	hsa-miR-4747-5p	CLIP-seq
MIRT1135036	hsa-miR-491-5p	CLIP-seq
MIRT1135037	hsa-miR-541	CLIP-seq
MIRT1135038	hsa-miR-548t	CLIP-seq
MIRT1135039	hsa-miR-582-3p	CLIP-seq
MIRT1135040	hsa-miR-595	CLIP-seq
MIRT1135041	hsa-miR-654-5p	CLIP-seq

Show/Hide all(9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15701600
GO:0005634	Component	Nucleus	IEA
GO:0006346	Process	DNA methylation-dependent constitutive heterochromatin formation	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	15701600
GO:0008327	Function	Methyl-CpG binding	IBA
GO:1902275	Process	Regulation of chromatin organization	IDA	15701600

MIM	HGNC	e!Ensembl
607964	18532	ENSG00000230522

Protein

UniProt ID

Q8NHZ7

Protein name

Methyl-CpG-binding domain protein 3-like 2 (MBD3-like protein 2)

Protein function

May displace the NuRD complex from chromatin.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16564	MBDa	28 → 98	p55-binding region of Methyl-CpG-binding domain proteins MBD	Domain
PF14048	MBD_C	102 → 193	C-terminal domain of methyl-CpG binding protein 2 and 3	Family

Tissue specificity

TISSUE SPECIFICITY: Detected at low levels in several somatic tissues (PubMed:12504854, PubMed:15701600). Highly expressed in the ovarian teratocarcinoma cell line PA-1 (PubMed:12504854). {ECO:0000269|PubMed:12504854, ECO:0000269|PubMed:15701600}.

Sequence

MGEPAFTSFPSLPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRP
VTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAP
GTAGESLDRAGAERVRSPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQAR
RVKKARERLAKALQADRLARRAEMLTGG

Sequence length

208

Interactions

View interactions

MBD3L2 (methyl-CpG binding domain protein 3 like 2)