OR7D4 (olfactory receptor family 7 subfamily D member 4)

Gene

• Entrez ID: 125958
• Gene name: Olfactory receptor family 7 subfamily D member 4
• Gene symbol: OR7D4
• Synonyms (NCBI Gene): OR19-7, OR19-B, OR19B, OR7D4P, hg105
• Chromosome: 19
• Chromosome location: 19p13.2
• Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004984	Function	Olfactory receptor activity	IBA
GO:0004984	Function	Olfactory receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0016020	Component	Membrane	IEA
GO:0050911	Process	Detection of chemical stimulus involved in sensory perception of smell	IEA

Other IDs

• MIM: 611538
• HGNC: 8380
• e!Ensembl: ENSG00000174667

Protein

• UniProt ID: Q8NG98
• Protein name: Olfactory receptor 7D4 (OR19-B) (Odorant receptor family subfamily D member 4RT) (Olfactory receptor OR19-7)
• Protein function: Odorant receptor. Selectively activated by androstenone and the related odorous steroid androstadienone.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13853	7tm_4	31 → 308	Olfactory receptor	Family

• Tissue specificity: TISSUE SPECIFICITY: Nasal olfactory epithelium. {ECO:0000269|PubMed:17509148}.
• Sequence:

  MEAENLTELSKFLLLGLSDDPELQPVLFGLFLSMYLVTVLGNLLIILAVSSDSHLHTPMY
  FFLSNLSFVDICFISTTVPKMLVSIQARSKDISYMGCLTQVYFLMMFAGMDTFLLAVMAY
  DRFVAICHPLHYTVIMNPCLCGLLVLASWFIIFWFSLVHILLMKRLTFSTGTEIPHFFCE
  PAQVLKVACSNTLLNNIVLYVATALLGVFPVAGILFSYSQIVSSLMGMSSTKGKYKAFST
  CGSHLCVVSLFYGTGLGVYLSSAVTHSSQSSSTASVMYAMVTPMLNPFIYSLRNKDVKGA
  LERLLSRADSCP

• Sequence length: 312

Pathways

KEGG:

Olfactory transduction

Reactome:

Olfactory Signaling Pathway