CYB5D2 (cytochrome b5 domain containing 2)

Gene

• Entrez ID: 124936
• Gene name: Cytochrome b5 domain containing 2
• Gene symbol: CYB5D2
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17p13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT047145	hsa-miR-183-5p	CLASH	23622248
MIRT919521	hsa-miR-1915	CLIP-seq
MIRT919522	hsa-miR-324-5p	CLIP-seq
MIRT919523	hsa-miR-3612	CLIP-seq
MIRT919524	hsa-miR-4459	CLIP-seq
MIRT919525	hsa-miR-4685-5p	CLIP-seq
MIRT919526	hsa-miR-4695-5p	CLIP-seq
MIRT919527	hsa-miR-4726-3p	CLIP-seq
MIRT919528	hsa-miR-650	CLIP-seq
MIRT919529	hsa-miR-665	CLIP-seq
MIRT1972582	hsa-miR-1290	CLIP-seq
MIRT1972583	hsa-miR-298	CLIP-seq
MIRT1972584	hsa-miR-300	CLIP-seq
MIRT1972585	hsa-miR-3167	CLIP-seq
MIRT1972586	hsa-miR-3180-5p	CLIP-seq
MIRT1972587	hsa-miR-3678-3p	CLIP-seq
MIRT1972588	hsa-miR-3713	CLIP-seq
MIRT1972589	hsa-miR-381	CLIP-seq
MIRT1972590	hsa-miR-4253	CLIP-seq
MIRT1972591	hsa-miR-4718	CLIP-seq
MIRT1972592	hsa-miR-4782-5p	CLIP-seq
MIRT1972593	hsa-miR-520a-5p	CLIP-seq
MIRT1972594	hsa-miR-525-5p	CLIP-seq
MIRT1972595	hsa-miR-548p	CLIP-seq
MIRT1972596	hsa-miR-876-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005496	Function	Steroid binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0012505	Component	Endomembrane system	IBA
GO:0016020	Component	Membrane	IBA
GO:0020037	Function	Heme binding	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q8WUJ1
• Protein name: Neuferricin (Cytochrome b5 domain-containing protein 2)
• Protein function: Heme-binding protein which promotes neuronal but not astrocyte differentiation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00173	Cyt-b5	39 → 134	Cytochrome b5-like Heme/Steroid binding domain	Domain

• Sequence:

  MLRCGGRGLLLGLAVAAAAVMAARLMGWWGPRAGFRLFIPEELSRYRGGPGDPGLYLALL
  GRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDCSEAGLVDDVSDLSAAEMLTLHNWL
  SFYEKNYVCVGRVTGRFYGEDGLPTPALTQVEAAITRGLEANKLQLQEKQTFPPCNAEWS
  SARGSRLWCSQKSGGVSRDWIGVPRKLYKPGAKEPRCVCVRTTGPPSGQMPDNPPHRNRG
  DLDHPNLAEYTGCPPLAITCSFPL

• Sequence length: 264

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Glioblastoma	Glioblastoma	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Atypical Squamous Cells of the Cervix	Associate	40395557
Breast Neoplasms	Associate	32883354
Carcinoma Hepatocellular	Associate	36881382
Carcinoma Renal Cell	Associate	36530957
Carcinoma Squamous Cell	Associate	40395557
Neoplasms	Inhibit	40395557
Squamous Intraepithelial Lesions	Associate	40395557
Uterine Cervical Neoplasms	Associate	40395557
Uterine Cervicitis	Inhibit	40395557