Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
124872
Gene name Gene Name - the full gene name approved by the HGNC.
Beta-1,4-N-acetyl-galactosaminyltransferase 2 (SID blood group)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
B4GALNT2
Synonyms (NCBI Gene) Gene synonyms aliases
B4GALT, GALGT2
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
B4GALNT2 catalyzes the last step in the biosynthesis of the human Sd(a) antigen through the addition of an N-acetylgalactosamine residue via a beta-1,4 linkage to a subterminal galactose residue substituted with an alpha-2,3-linked sialic acid. B4GALNT2 a
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT813461 hsa-miR-1207-5p CLIP-seq
MIRT813462 hsa-miR-1256 CLIP-seq
MIRT813463 hsa-miR-3714 CLIP-seq
MIRT813464 hsa-miR-4761-3p CLIP-seq
MIRT813465 hsa-miR-4763-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0005515 Function Protein binding IPI 32296183
GO:0006047 Process UDP-N-acetylglucosamine metabolic process IBA 21873635
GO:0008376 Function Acetylgalactosaminyltransferase activity IBA 21873635
GO:0008376 Function Acetylgalactosaminyltransferase activity IDA 12678917, 14688233
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
111730 24136 ENSG00000167080
Protein
UniProt ID Q8NHY0
Protein name Beta-1,4 N-acetylgalactosaminyltransferase 2 (EC 2.4.1.-) (Sd(a) beta-1,4-GalNAc transferase) (UDP-GalNAc:Neu5Aca2-3Galb-R b1,4-N-acetylgalactosaminyltransferase)
Protein function Beta-1,4 N-acetylgalactosaminyltransferase involved in the biosynthesis of Sd(a) histo-blood group antigen. Catalyzes the transfer of N-acetylgalactosamine (GalNAc) group in a beta-1,4-linkage from UDP-GalNAc to the galactose residue of NeuAcalp
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00535 Glycos_transf_2 324 470 Glycosyl transferase family 2 Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in colon and to a lesser extent in kidney, stomach, ileum and rectum. {ECO:0000269|PubMed:12678917}.
Sequence
MGSAGFSVGKFHVEVASRGRECVSGTPECGNRLGSAGFGALCLELRGADPAWGPFAAHGR
SRRQGSRFLWLLKILVIILVLGIVGFMFGSMFLQAVFSSPKPELPSPAPGVQKLKLLPEE
RLRNLFSYDGIWLFPKNQCKCEANKEQGGYNFQDAYGQSDLPAVKARRQAEFEHFQRREG
LPRPLPLLVQPNLPFGYPVHGVEVMPLHTVPIPGLQFEGPDAPVYEVTLTASLGTLNTLA
DVPDSVVQGRGQKQLIISTSDRKLLKFILQHVTYTSTGYQHQKVDIVSLESRSSVAKFPV
TIRHPVIPKLYDPGPERKLRNLVTIATKTFLRPHKLMIMLRSIREYYPDLTVIVADDSQK
PLEIKDNHVEYYTMPFGKGWFAGRNLAISQVTTKYVLWVDDDFLFNEETKIEVLVDVLEK
TELDVVGGSVLGNVFQFKLLLEQSENGACLHKRMGFFQPLDGFPSCVVTS
GVVNFFLAHT
ERLQRVGFDPRLQRVAHSEFFIDGLGTLLVGSCPEVIIGHQSRSPVVDSELAALEKTYNT
YRSNTLTRVQFKLALHYFKNHLQCAA
Sequence length 566
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
  Asparagine N-linked glycosylation
Lewis blood group biosynthesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Coronary artery disease Coronary Artery Disease rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537 29212778
Unknown
Disease term Disease name Evidence References Source
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 39261800
Carcinogenesis Associate 33919332
Colorectal Neoplasms Associate 32290493
Colorectal Neoplasms Inhibit 32911675, 33919332
Coronary Artery Disease Associate 31830326
Crohn Disease Associate 39261800
Leukemia Associate 20484983
Leukemia Lymphocytic Chronic B Cell Associate 20484983
Neoplasms Inhibit 32290493, 32911675, 33919332