Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	124641
Gene name Gene Name - the full gene name approved by the HGNC.	OVCA2 serine hydrolase domain containing
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	OVCA2
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p13.3

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020587	hsa-miR-155-5p	Proteomics	18668040
MIRT1208299	hsa-miR-1255a	CLIP-seq
MIRT1208300	hsa-miR-1255b	CLIP-seq
MIRT1208301	hsa-miR-1343	CLIP-seq
MIRT1208302	hsa-miR-3174	CLIP-seq
MIRT1208303	hsa-miR-3192	CLIP-seq
MIRT1208304	hsa-miR-3616-3p	CLIP-seq
MIRT1208305	hsa-miR-3622b-5p	CLIP-seq
MIRT1208306	hsa-miR-3689a-3p	CLIP-seq
MIRT1208307	hsa-miR-3689c	CLIP-seq
MIRT1208308	hsa-miR-4253	CLIP-seq
MIRT1208309	hsa-miR-4481	CLIP-seq
MIRT1208310	hsa-miR-4519	CLIP-seq
MIRT1208311	hsa-miR-4728-5p	CLIP-seq
MIRT1208312	hsa-miR-4745-5p	CLIP-seq
MIRT1208313	hsa-miR-4758-5p	CLIP-seq
MIRT1208314	hsa-miR-4761-3p	CLIP-seq
MIRT1208315	hsa-miR-490-5p	CLIP-seq
MIRT2059837	hsa-miR-2355-5p	CLIP-seq
MIRT2059838	hsa-miR-4297	CLIP-seq
MIRT2059839	hsa-miR-582-3p	CLIP-seq
MIRT2586315	hsa-miR-1207-5p	CLIP-seq
MIRT2586316	hsa-miR-1245b-5p	CLIP-seq
MIRT2586317	hsa-miR-218	CLIP-seq
MIRT2586318	hsa-miR-3127-3p	CLIP-seq
MIRT2586319	hsa-miR-3142	CLIP-seq
MIRT2586320	hsa-miR-3918	CLIP-seq
MIRT2586321	hsa-miR-4312	CLIP-seq
MIRT2586322	hsa-miR-4436b-3p	CLIP-seq
MIRT2586323	hsa-miR-4457	CLIP-seq
MIRT2586324	hsa-miR-4659a-3p	CLIP-seq
MIRT2586325	hsa-miR-4659b-3p	CLIP-seq
MIRT2586326	hsa-miR-4753-5p	CLIP-seq
MIRT2586327	hsa-miR-4763-3p	CLIP-seq
MIRT2586328	hsa-miR-5096	CLIP-seq
MIRT2586329	hsa-miR-513b	CLIP-seq
MIRT2586330	hsa-miR-515-5p	CLIP-seq
MIRT2586331	hsa-miR-664	CLIP-seq
MIRT2586332	hsa-miR-885-5p	CLIP-seq

Show/Hide all(6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	16368187
GO:0016787	Function	Hydrolase activity	NAS	11979432
GO:0032526	Process	Response to retinoic acid	IBA	21873635
GO:0032526	Process	Response to retinoic acid	IDA	11979432

MIM	HGNC	e!Ensembl
607896	24203	ENSG00000262664

Protein

UniProt ID

Q8WZ82

Protein name

Esterase OVCA2 (EC 3.1.1.1) (OVCA2 serine hydrolase domain-containing protein) (Ovarian cancer-associated gene 2 protein)

Protein function

Exhibits ester hydrolase activity with a strong preference for long-chain alkyl ester substrates and high selectivity against a variety of short, branched, and substituted esters. Is able to hydrolyze ester bonds within a wide range of p-nitroph

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03959	FSH1	1 → 218	Serine hydrolase (FSH1)	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:11979432, ECO:0000269|PubMed:8616839}.

Sequence

MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSD
FGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQ
GAALAALVCALGQAGDPRFPLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDK
VIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE

Sequence length

227

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Multiple Myeloma	Associate	33531688
Neoplasms	Associate	31059574

OVCA2 (OVCA2 serine hydrolase domain containing)