ZPBP2 (zona pellucida binding protein 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
124626
Gene name Gene Name - the full gene name approved by the HGNC.
Zona pellucida binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZPBP2
Synonyms (NCBI Gene) Gene synonyms aliases
ZPBPL
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(24)
miRTarBase ID miRNA Experiments Reference
MIRT017875 hsa-miR-335-5p Microarray 18185580
MIRT1543373 hsa-miR-185 CLIP-seq
MIRT1543374 hsa-miR-4306 CLIP-seq
MIRT1543375 hsa-miR-4644 CLIP-seq
MIRT1543376 hsa-miR-4802-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(18)
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IBA
GO:0001669 Component Acrosomal vesicle IEA
GO:0001675 Process Acrosome assembly IBA
GO:0001675 Process Acrosome assembly IEA
GO:0002199 Component Zona pellucida receptor complex IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
608499 20678 ENSG00000186075
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q6X784
Protein name Zona pellucida-binding protein 2 (ZPBP-like protein)
Protein function Is implicated in sperm-oocyte interaction during fertilization.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07354 Sp38 150 → 327 Zona-pellucida-binding protein (Sp38) Family
Tissue specificity TISSUE SPECIFICITY: Expressed specifically in testis. {ECO:0000269|PubMed:17664285}.
Sequence 
MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNSPVLICMDFKL
SKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAET
QEEKTVKKRYDFMVFAYREPDYSYQMAVRFTTRSCIGRYNDVFFRVLKKILDSLISDLSC
HVIEPSYKCHSVEIPEHGLIHELFIAFQVNPFAPGWKGACNGSVDCEDTTNHNILQARDR
IEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRPGFGKNERLHSNCASCCVVCS
PATFSPDVNVTCQTCVSVLTYGAKSCPQTSNKNQQYED
Sequence length 338
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (9)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset), Nonatopic asthma, Asthma, Asthma (age of onset), Asthma (time to onset) N/A N/A GWAS
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Biliary Cirrhosis Primary biliary cirrhosis N/A N/A GWAS
Cervical Cancer Cervical cancer N/A N/A GWAS
Show/Hide Text Mining Associations (10)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Asthma Associate 19732864, 21985515, 22271045, 25895113, 27835674, 27848966, 28241063, 31439681, 32240371, 33653805, 36967681
Autoimmune Diseases Associate 19732864
Crohn Disease Inhibit 26484354
Graves Disease Associate 29510406
Inflammation Associate 27835674
Inflammatory Bowel Diseases Associate 25895113
Inflammatory Bowel Diseases Inhibit 26484354
Liver Cirrhosis Biliary Associate 28588209
Lupus Erythematosus Systemic Associate 22464253, 25271777
Respiratory Sounds Associate 33653805, 36967681