Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
124590
Gene name Gene Name - the full gene name approved by the HGNC.
USH1 protein network component sans
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
USH1G
Synonyms (NCBI Gene) Gene synonyms aliases
ANKS4A, SANS
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that contains three ankyrin domains, a class I PDZ-binding motif and a sterile alpha motif. The encoded protein interacts with harmonin, which is associated with Usher syndrome type 1C. This protein plays a role in the developm
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs142486910 G>C Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, missense variant
rs147967199 T>G Conflicting-interpretations-of-pathogenicity, likely-benign Missense variant, coding sequence variant
rs201866631 C>A,T Pathogenic, uncertain-significance Stop gained, coding sequence variant, missense variant
rs397515345 ACGCTGTCCTCGTCCGAGAG>- Pathogenic Frameshift variant, coding sequence variant
rs397517925 T>A Likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT621598 hsa-miR-8485 HITS-CLIP 23824327
MIRT611302 hsa-miR-4643 HITS-CLIP 23824327
MIRT611301 hsa-miR-8064 HITS-CLIP 23824327
MIRT621598 hsa-miR-8485 HITS-CLIP 23824327
MIRT611302 hsa-miR-4643 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001917 Component Photoreceptor inner segment IDA 24608321
GO:0001917 Component Photoreceptor inner segment IEA
GO:0005515 Function Protein binding IPI 19028668, 20142502, 24608321, 25502805, 27173435, 28514442, 29997244, 31515488, 31637240, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607696 16356 ENSG00000182040
Protein
UniProt ID Q495M9
Protein name pre-mRNA splicing regulator USH1G (Scaffold protein containing ankyrin repeats and SAM domain) (Usher syndrome type-1G protein)
Protein function Plays a role in pre-mRNA splicing by regulating the release and transfer of U4/U6.U5 tri-small nuclear ribonucleoprotein (tri-snRNP) complexes from their assembly site in Cajal bodies to nuclear speckles, thereby contributing to the assembly of
PDB 2L7T , 3K1R , 3PVL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 37 126 Ankyrin repeats (3 copies) Repeat
PF00536 SAM_1 388 447 SAM domain (Sterile alpha motif) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in vestibule of the inner ear, eye and small intestine. {ECO:0000269|PubMed:12588794}.
Sequence
MNDQYHRAARDGYLELLKEATRKELNAPDEDGMTPTLWAAYHGNLESLRLIVSRGGDPDK
CDIWGNTPLHLAASNGHLHCLSFLVSFGANIWCLDNDYHTPLDMAAMKGHMECVRYLDSI
AAKQSS
LNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMERRYRRELAERSDTLSFSS
LTSSTLSRRLQHLALGSHLPYSQATLHGTARGKTKMQKKLERRKQGGEGTFKVSEDGRKS
ARSLSGLQLGSDVMFVRQGTYANPKEWGRAPLRDMFLSDEDSVSRATLAAEPAHSEVSTD
SGHDSLFTRPGLGTMVFRRNYLSSGLHGLGREDGGLDGVGAPRGRLQSSPSLDDDSLGSA
NSLQDRSCGEELPWDELDLGLDEDLEPETSPLETFLASLHMEDFAALLRQEKIDLEALML
CSDLDLRSISVPLGPRKKILGAVRRRR
QAMERPPALEDTEL
Sequence length 461
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
hearing impairment Hearing impairment rs1567939718, rs1567940507 N/A
Usher Syndrome Usher syndrome type 1G, usher syndrome type 1 rs587776546, rs104894652, rs1316299165, rs397517925, rs1598584825, rs886043626, rs1359109336, rs1555627787, rs104894651, rs730880268, rs397515345, rs201866631 N/A
deafness Deafness rs1567939793, rs201866631 N/A
Hearing Loss Hearing loss, autosomal recessive rs1567939793, rs201866631 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Optic Atrophy optic atrophy N/A N/A ClinVar
retinal dystrophy Retinal dystrophy N/A N/A ClinVar
Retinitis Pigmentosa Retinitis pigmentosa-deafness syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ciliopathies Associate 34023904
Deaf Blind Disorders Associate 34023904, 38139438
Deafness Associate 33095980
Hearing Loss Associate 12519370, 30872814, 33095980
Inflammation Associate 30872814
Usher syndrome type 1B Associate 16679490, 21203349, 22219650
Usher Syndromes Associate 22219650, 22876113, 25404053, 25575603, 25798947, 27583663, 34023904, 38139438