Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
124446
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein 219
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEM219
Synonyms (NCBI Gene) Gene synonyms aliases
IGFBP-3R, IGFBP3R
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p11.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT2645566 hsa-miR-1228 CLIP-seq
MIRT2645567 hsa-miR-3622a-3p CLIP-seq
MIRT2645568 hsa-miR-3622b-3p CLIP-seq
MIRT2645569 hsa-miR-4251 CLIP-seq
MIRT2645570 hsa-miR-4324 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20353938, 27629921, 29427412
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0006915 Process Apoptotic process IEA
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
620290 25201 ENSG00000149932
Protein
UniProt ID Q86XT9
Protein name Insulin-like growth factor-binding protein 3 receptor (IGFBP-3R) (Transmembrane protein 219)
Protein function Cell death receptor specific for IGFBP3, may mediate caspase-8-dependent apoptosis upon ligand binding.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14940 TMEM219 10 85 Transmembrane 219 Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed in normal tissues but suppressed in prostate and breast tumor. {ECO:0000269|PubMed:20353938}.
Sequence
MGNCQAGHNLHLCLAHHPPLVCATLILLLLGLSGLGLGSFLLTHRTGLRSPDIPQDWVSF
LRSFGQLTLCPRNGTVTGKWRGSHV
VGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGS
SAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVS
VWSHEGLVLTKLLTSEELALCGSRLLVLGSFLLLFCGLLCCVTAMCFHPRRESHWSRTRL
Sequence length 240
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    TP53 Regulates Transcription of Death Receptors and Ligands
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dental caries Dental caries N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Psychotic Disorders Associate 34715901
Schizophrenia Associate 34715901