Gene Gene information from NCBI Gene database.
Entrez ID 124152
Gene name IQ motif containing K
Gene symbol IQCK
Synonyms (NCBI Gene)
-
Chromosome 16
Chromosome location 16p12.3
Summary This gene belongs to the IQ motif-containing family of proteins. The IQ motif serves as a binding site for different EF-hand proteins such as calmodulin. This gene was identified as a potential candidate gene for obsessive-compulsive disorder in a genome-
miRNA miRNA information provided by mirtarbase database.
57
miRTarBase ID miRNA Experiments Reference
MIRT023147 hsa-miR-124-3p Microarray 18668037
MIRT1069713 hsa-miR-4457 CLIP-seq
MIRT1069714 hsa-miR-513b CLIP-seq
MIRT1069715 hsa-miR-548ag CLIP-seq
MIRT1069716 hsa-miR-548ai CLIP-seq
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N0W5
Protein name IQ domain-containing protein K
Family and domains
Sequence
MAAPRQIPSHIVRLKPSCSTDSSFTRTPVPTVSLASRELPVSSWQVTEPSSKNLWEQICK
EYEAEQPPFPEGYKVKQEPVITVAPVEEMLFHGFSAEHYFPVSHFTMISRTPCPQDKSET
INPKTCSPKEYLETFIFPVLLPGMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPK
RAGEPFTEFFSIPFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWRACVVRCDPEIQEL
RQWQKKLREAKHIHQQVKIFWAKQEQKVKCKMEDDAVPAAKMKIPSS
Sequence length 287
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hepatocellular carcinoma Uncertain significance rs202079334 RCV005928993
Ovarian serous cystadenocarcinoma Uncertain significance rs751331784 RCV005932653
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 32740652, 34767070
Immunoglobulin G4 Related Disease Associate 36609529
Multiple System Atrophy Associate 27470294
Obsessive Compulsive Disorder Associate 24821223