Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	124152
Gene name Gene Name - the full gene name approved by the HGNC.	IQ motif containing K
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IQCK
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p12.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene belongs to the IQ motif-containing family of proteins. The IQ motif serves as a binding site for different EF-hand proteins such as calmodulin. This gene was identified as a potential candidate gene for obsessive-compulsive disorder in a genome-

Show/Hide all(57)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023147	hsa-miR-124-3p	Microarray	18668037
MIRT1069713	hsa-miR-4457	CLIP-seq
MIRT1069714	hsa-miR-513b	CLIP-seq
MIRT1069715	hsa-miR-548ag	CLIP-seq
MIRT1069716	hsa-miR-548ai	CLIP-seq
MIRT1069717	hsa-miR-660	CLIP-seq
MIRT2017166	hsa-miR-1200	CLIP-seq
MIRT2017167	hsa-miR-1207-3p	CLIP-seq
MIRT2017168	hsa-miR-1231	CLIP-seq
MIRT2017169	hsa-miR-138	CLIP-seq
MIRT2017170	hsa-miR-1827	CLIP-seq
MIRT2017171	hsa-miR-3120-5p	CLIP-seq
MIRT2017172	hsa-miR-3121-5p	CLIP-seq
MIRT2017173	hsa-miR-4289	CLIP-seq
MIRT2017174	hsa-miR-4324	CLIP-seq
MIRT2017175	hsa-miR-4649-3p	CLIP-seq
MIRT2017176	hsa-miR-501-5p	CLIP-seq
MIRT2017177	hsa-miR-502-5p	CLIP-seq
MIRT2017178	hsa-miR-544b	CLIP-seq
MIRT2017179	hsa-miR-629	CLIP-seq
MIRT2017180	hsa-miR-646	CLIP-seq
MIRT2249126	hsa-miR-374a	CLIP-seq
MIRT2249127	hsa-miR-374b	CLIP-seq
MIRT2451918	hsa-miR-1246	CLIP-seq
MIRT2451919	hsa-miR-4484	CLIP-seq
MIRT2451920	hsa-miR-450b-5p	CLIP-seq
MIRT2451921	hsa-miR-518a-5p	CLIP-seq
MIRT2451922	hsa-miR-527	CLIP-seq
MIRT2017168	hsa-miR-1231	CLIP-seq
MIRT2552721	hsa-miR-3065-5p	CLIP-seq
MIRT2017171	hsa-miR-3120-5p	CLIP-seq
MIRT2017172	hsa-miR-3121-5p	CLIP-seq
MIRT2552722	hsa-miR-4668-3p	CLIP-seq
MIRT2552723	hsa-miR-500a	CLIP-seq
MIRT2017176	hsa-miR-501-5p	CLIP-seq
MIRT2552724	hsa-miR-548c-3p	CLIP-seq
MIRT2017179	hsa-miR-629	CLIP-seq
MIRT2017168	hsa-miR-1231	CLIP-seq
MIRT2552721	hsa-miR-3065-5p	CLIP-seq
MIRT2017171	hsa-miR-3120-5p	CLIP-seq
MIRT2017172	hsa-miR-3121-5p	CLIP-seq
MIRT2682891	hsa-miR-3147	CLIP-seq
MIRT2682892	hsa-miR-3173-3p	CLIP-seq
MIRT2682893	hsa-miR-3545-5p	CLIP-seq
MIRT2682894	hsa-miR-3940-5p	CLIP-seq
MIRT2682895	hsa-miR-4425	CLIP-seq
MIRT2682896	hsa-miR-4428	CLIP-seq
MIRT2682897	hsa-miR-4477b	CLIP-seq
MIRT2682898	hsa-miR-4507	CLIP-seq
MIRT2552722	hsa-miR-4668-3p	CLIP-seq
MIRT2552723	hsa-miR-500a	CLIP-seq
MIRT2017176	hsa-miR-501-5p	CLIP-seq
MIRT2552724	hsa-miR-548c-3p	CLIP-seq
MIRT2682899	hsa-miR-548n	CLIP-seq
MIRT2682900	hsa-miR-548t	CLIP-seq
MIRT2682901	hsa-miR-595	CLIP-seq
MIRT2017179	hsa-miR-629	CLIP-seq

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

Q8N0W5

Protein name

IQ domain-containing protein K

Family and domains

Sequence

MAAPRQIPSHIVRLKPSCSTDSSFTRTPVPTVSLASRELPVSSWQVTEPSSKNLWEQICK
EYEAEQPPFPEGYKVKQEPVITVAPVEEMLFHGFSAEHYFPVSHFTMISRTPCPQDKSET
INPKTCSPKEYLETFIFPVLLPGMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPK
RAGEPFTEFFSIPFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWRACVVRCDPEIQEL
RQWQKKLREAKHIHQQVKIFWAKQEQKVKCKMEDDAVPAAKMKIPSS

Sequence length

287

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or gastroesophageal reflux disease	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	32740652, 34767070
Immunoglobulin G4 Related Disease	Associate	36609529
Multiple System Atrophy	Associate	27470294
Obsessive Compulsive Disorder	Associate	24821223

IQCK (IQ motif containing K)