Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1241
Gene name	Leukotriene B4 receptor
Gene symbol	LTB4R
Synonyms (NCBI Gene)	BLT1BLTRCMKRL1GPR16LTB4R1LTBR1P2RY7P2Y7
Chromosome	14
Chromosome location	14q12

Show/Hide all (84)

miRTarBase ID	miRNA	Experiments
MIRT1122096	hsa-miR-1207-3p	CLIP-seq
MIRT1122097	hsa-miR-122	CLIP-seq
MIRT1122098	hsa-miR-2117	CLIP-seq
MIRT1122099	hsa-miR-3161	CLIP-seq
MIRT1122100	hsa-miR-371-5p	CLIP-seq
MIRT1122101	hsa-miR-371b-5p	CLIP-seq
MIRT1122102	hsa-miR-4254	CLIP-seq
MIRT1122103	hsa-miR-4273	CLIP-seq
MIRT1122104	hsa-miR-4281	CLIP-seq
MIRT1122105	hsa-miR-4330	CLIP-seq
MIRT1122106	hsa-miR-4449	CLIP-seq
MIRT1122107	hsa-miR-4491	CLIP-seq
MIRT1122108	hsa-miR-4519	CLIP-seq
MIRT1122109	hsa-miR-4532	CLIP-seq
MIRT1122110	hsa-miR-4657	CLIP-seq
MIRT1122111	hsa-miR-4684-3p	CLIP-seq
MIRT1122112	hsa-miR-4754	CLIP-seq
MIRT1122113	hsa-miR-4765	CLIP-seq
MIRT1122114	hsa-miR-490-3p	CLIP-seq
MIRT1122115	hsa-miR-493	CLIP-seq
MIRT1122116	hsa-miR-512-3p	CLIP-seq
MIRT1122117	hsa-miR-513c	CLIP-seq
MIRT1122118	hsa-miR-514b-5p	CLIP-seq
MIRT1122119	hsa-miR-619	CLIP-seq
MIRT1122120	hsa-miR-1179	CLIP-seq
MIRT1122096	hsa-miR-1207-3p	CLIP-seq
MIRT1122121	hsa-miR-149	CLIP-seq
MIRT1122098	hsa-miR-2117	CLIP-seq
MIRT1122122	hsa-miR-24	CLIP-seq
MIRT1122100	hsa-miR-371-5p	CLIP-seq
MIRT1122101	hsa-miR-371b-5p	CLIP-seq
MIRT1122103	hsa-miR-4273	CLIP-seq
MIRT1122123	hsa-miR-4284	CLIP-seq
MIRT1122124	hsa-miR-4727-5p	CLIP-seq
MIRT1122125	hsa-miR-4769-3p	CLIP-seq
MIRT1122117	hsa-miR-513c	CLIP-seq
MIRT1122118	hsa-miR-514b-5p	CLIP-seq
MIRT1122126	hsa-miR-621	CLIP-seq
MIRT1122127	hsa-miR-892b	CLIP-seq
MIRT1122096	hsa-miR-1207-3p	CLIP-seq
MIRT1122098	hsa-miR-2117	CLIP-seq
MIRT1122100	hsa-miR-371-5p	CLIP-seq
MIRT1122101	hsa-miR-371b-5p	CLIP-seq
MIRT1122103	hsa-miR-4273	CLIP-seq
MIRT1122117	hsa-miR-513c	CLIP-seq
MIRT1122118	hsa-miR-514b-5p	CLIP-seq
MIRT2034494	hsa-miR-642a	CLIP-seq
MIRT1122096	hsa-miR-1207-3p	CLIP-seq
MIRT2390388	hsa-miR-1281	CLIP-seq
MIRT1122098	hsa-miR-2117	CLIP-seq
MIRT1122100	hsa-miR-371-5p	CLIP-seq
MIRT1122101	hsa-miR-371b-5p	CLIP-seq
MIRT2390389	hsa-miR-4258	CLIP-seq
MIRT1122103	hsa-miR-4273	CLIP-seq
MIRT1122117	hsa-miR-513c	CLIP-seq
MIRT1122118	hsa-miR-514b-5p	CLIP-seq
MIRT2390390	hsa-miR-532-3p	CLIP-seq
MIRT2390391	hsa-miR-662	CLIP-seq
MIRT2453496	hsa-miR-296-5p	CLIP-seq
MIRT2453497	hsa-miR-3184	CLIP-seq
MIRT2453498	hsa-miR-423-5p	CLIP-seq
MIRT1122104	hsa-miR-4281	CLIP-seq
MIRT1122105	hsa-miR-4330	CLIP-seq
MIRT1122106	hsa-miR-4449	CLIP-seq
MIRT2453499	hsa-miR-4523	CLIP-seq
MIRT1122109	hsa-miR-4532	CLIP-seq
MIRT2453500	hsa-miR-4685-5p	CLIP-seq
MIRT2453501	hsa-miR-4733-3p	CLIP-seq
MIRT2453502	hsa-miR-4758-3p	CLIP-seq
MIRT1122115	hsa-miR-493	CLIP-seq
MIRT2453496	hsa-miR-296-5p	CLIP-seq
MIRT2453497	hsa-miR-3184	CLIP-seq
MIRT2453498	hsa-miR-423-5p	CLIP-seq
MIRT2453499	hsa-miR-4523	CLIP-seq
MIRT2453500	hsa-miR-4685-5p	CLIP-seq
MIRT2453501	hsa-miR-4733-3p	CLIP-seq
MIRT2453502	hsa-miR-4758-3p	CLIP-seq
MIRT2453496	hsa-miR-296-5p	CLIP-seq
MIRT2453497	hsa-miR-3184	CLIP-seq
MIRT2453498	hsa-miR-423-5p	CLIP-seq
MIRT2453499	hsa-miR-4523	CLIP-seq
MIRT2453500	hsa-miR-4685-5p	CLIP-seq
MIRT2453501	hsa-miR-4733-3p	CLIP-seq
MIRT2453502	hsa-miR-4758-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	TAS	8702478
GO:0001632	Function	Leukotriene B4 receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004974	Function	Leukotriene receptor activity	IEA
GO:0004974	Function	Leukotriene receptor activity	TAS	9177352
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9177352
GO:0006936	Process	Muscle contraction	TAS	8702478
GO:0006954	Process	Inflammatory response	TAS	9177352
GO:0006955	Process	Immune response	TAS	9177352
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9177352
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	TAS	8702478
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0061737	Process	Leukotriene signaling pathway	IEA

MIM	HGNC	e!Ensembl
601531	6713	ENSG00000213903

Q15722

Protein name

Leukotriene B4 receptor 1 (LTB4-R 1) (LTB4-R1) (Chemoattractant receptor-like 1) (G-protein coupled receptor 16) (P2Y purinoceptor 7) (P2Y7)

Protein function

Receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac mu

PDB

7K15 , 7VKT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	35 → 285	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at highest levels in heart, skeletal muscle and at lower levels in brain and liver. High level of expression in lymphoid tissues.

Sequence

MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN

Sequence length

352

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Leukotriene receptors G alpha (q) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANAPHYLAXIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	31912564, 33788842	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Associate	16624877	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Associate	16179368, 24428972	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Associate	26696753	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Crisis	Associate	19654405	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	20187983, 27475906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Stimulate	34814348	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	26696753, 33968297, 36429034	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Associate	29116124	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	17220595	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Associate	7923869	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Associate	33788842	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	20109744	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Associate	32273829	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	26696753	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epstein Barr Virus Infections	Associate	16179368	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Stimulate	27475906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Associate	16179368	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	16179368, 31912564, 34814348, 34885819	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	19654405, 25193960	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	34814348	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	16532039, 17220595, 20187983, 27475906, 34814348, 38139172	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms Squamous Cell	Associate	27475906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	12163367	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Associate	32670289	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	24169960	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Associate	33949285	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Associate	34847389	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Asthmaticus	Associate	16179368, 24428972	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	20187983	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichomonas Infections	Associate	29859938	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	38139172	★★★★★ ★☆☆☆☆ Found in Text Mining only

LTB4R (leukotriene B4 receptor)