SPATA33 (spermatogenesis associated 33)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 124045
Gene name Spermatogenesis associated 33
Gene symbol SPATA33
Synonyms (NCBI Gene)
C16orf55
Chromosome 16
Chromosome location 16q24.3
miRNA miRNA information provided by mirtarbase database.
14
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (14)
miRTarBase ID miRNA Experiments Reference
MIRT740445 hsa-miR-4676-5p HITS-CLIP 19536157
MIRT740446 hsa-miR-575 HITS-CLIP 19536157
MIRT740447 hsa-miR-4639-3p HITS-CLIP 19536157
MIRT740448 hsa-miR-4704-3p HITS-CLIP 19536157
MIRT740449 hsa-miR-3921 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (12)
GO ID Ontology Definition Evidence Reference
GO:0000423 Process Mitophagy ISS
GO:0005515 Function Protein binding IPI 32296183, 33961781, 34446558
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
615409 26463 ENSG00000167523
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96N06
Protein name Spermatogenesis-associated protein 33
Protein function Plays an important role in sperm motility and male fertility (By similarity). Required for sperm midpiece flexibility and for the localization of sperm calcineurin to the mitochondria (By similarity). Promotes mitophagy as well as acts as an aut
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15382 DUF4609 70 → 137 Domain of unknown function (DUF4609) Family
Sequence 
MVTHAAGARTFCEEQKKGSTYSVPKSKEKLMEKHSQEARQADRESEKPVDSLHPGAGTAK
HPPPAASLEEKPDVKQKSSRKKVVVPQIIITRASNETLVSCSSSGSDQQRTIREPEDWGP
YRRHRNPSTADAYNSHLKE
Sequence length 139
Interactions View interactions