SPATA33 (spermatogenesis associated 33)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
124045
Gene name Gene Name - the full gene name approved by the HGNC.
Spermatogenesis associated 33
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPATA33
Synonyms (NCBI Gene) Gene synonyms aliases
C16orf55
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q24.3
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(14)
miRTarBase ID miRNA Experiments Reference
MIRT740445 hsa-miR-4676-5p HITS-CLIP 19536157
MIRT740446 hsa-miR-575 HITS-CLIP 19536157
MIRT740447 hsa-miR-4639-3p HITS-CLIP 19536157
MIRT740448 hsa-miR-4704-3p HITS-CLIP 19536157
MIRT740449 hsa-miR-3921 HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IBA 21873635
GO:0005737 Component Cytoplasm IBA 21873635
GO:0005829 Component Cytosol IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
615409 26463 ENSG00000167523
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96N06
Protein name Spermatogenesis-associated protein 33
Protein function Plays an important role in sperm motility and male fertility (By similarity). Required for sperm midpiece flexibility and for the localization of sperm calcineurin to the mitochondria (By similarity). Promotes mitophagy as well as acts as an aut
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15382 DUF4609 70 → 137 Domain of unknown function (DUF4609) Family
Sequence 
MVTHAAGARTFCEEQKKGSTYSVPKSKEKLMEKHSQEARQADRESEKPVDSLHPGAGTAK
HPPPAASLEEKPDVKQKSSRKKVVVPQIIITRASNETLVSCSSSGSDQQRTIREPEDWGP
YRRHRNPSTADAYNSHLKE
Sequence length 139
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Carcinoma Squamous cell carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 26829030
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)		 21706340
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Gout Gout GWAS
Actinic keratosis Actinic keratosis GWAS
Show/Hide Text Mining Associations (3)
Associations from Text Mining
Disease Name Relationship Type References
Melanoma Associate 31630191
Neoplasms Associate 36099812
Primary Ovarian Insufficiency Associate 36099812