Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
123872
Gene name Gene Name - the full gene name approved by the HGNC.
Dynein axonemal assembly factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DNAAF1
Synonyms (NCBI Gene) Gene synonyms aliases
CILD13, DAU1, LRRC50, ODA7, swt
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is cilium-specific and is required for the stability of the ciliary architecture. It is involved in the regulation of microtubule-based cilia and actin-based brush border microvilli. Mutations in this gene are associated w
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs139519641 G>A Likely-pathogenic, uncertain-significance, benign Non coding transcript variant, coding sequence variant, splice donor variant, missense variant
rs139566676 C>A,T Conflicting-interpretations-of-pathogenicity Non coding transcript variant, synonymous variant, coding sequence variant, genic upstream transcript variant
rs144018942 C>A,G Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, non coding transcript variant, missense variant, genic upstream transcript variant
rs267607225 C>T Pathogenic Non coding transcript variant, stop gained, coding sequence variant
rs267607226 C>A Pathogenic Non coding transcript variant, stop gained, coding sequence variant
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000922 Component Spindle pole IEA
GO:0001947 Process Heart looping IMP 19944400, 19944405
GO:0003341 Process Cilium movement IMP 19944405
GO:0003356 Process Regulation of cilium beat frequency IMP 19944400
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613190 30539 ENSG00000154099
Protein
UniProt ID Q8NEP3
Protein name Dynein axonemal assembly factor 1 (Leucine-rich repeat-containing protein 50)
Protein function Cilium-specific protein required for the stability of the ciliary architecture. Plays a role in cytoplasmic preassembly of dynein arms. Involved in regulation of microtubule-based cilia and actin-based brush border microvilli. {ECO:0000269|PubMe
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14580 LRR_9 172 306 Repeat
Tissue specificity TISSUE SPECIFICITY: Mainly expressed in trachea and testis. {ECO:0000269|PubMed:19944405}.
Sequence
MHPEPSEPATGGAAELDCAQEPGVEESAGDHGSAGRGGCKEEINDPKEICVGSSDTSYHS
QQKQSGDNGSGGHFAHPREDREDRGPRMTKSSLQKLCKQHKLYITPALNDTLYLHFKGFD
RIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLFLQMNLLRKIENLEPLQKLDALNL
SNNYIKTIENLSCLPVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHNKLSDPEILSI
LESMPDLRVLNLMGNPVIRQIPNYRRTVTVRLKHLTYLDDRPVFPKDRACAEAWARGGYA
AEKEER
QQWESRERKKITDSIEALAMIKQRAEERKRQRESQERGEMTSSDDGENVPASAE
GKEEPPGDRETRQKMELFVKESFEAKDELCPEKPSGEEPPVEAKREDGGPEPEGTLPAET
LLLSSPVEVKGEDGDGEPEGTLPAEAPPPPPPVEVKGEDGDQEPEGTLPAETLLLSPPVK
VKGEDGDREPEGTLPAEAPPPPPLGAAREEPTPQAVATEGVFVTELDGTRTEDLETIRLE
TKETFCIDDLPDLEDDDETGKSLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPT
DTLSNIFAVSKDTSKAARVPFTDIFKKEAKRDLEIRKQDTKSPRPLIQELSDEDPSGQLL
MPPTCQRDAAPLTSSGDRDSDFLAASSPVPTESAATPPETCVGVAQPSQALPTWDLTAFP
APKAS
Sequence length 725
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Ciliary dyskinesia Primary ciliary dyskinesia 13, primary ciliary dyskinesia rs267607227, rs1555527001, rs761851970, rs397515339, rs1060502829, rs748869874, rs758650222, rs1489377964, rs1555526915, rs267607225, rs1555519999, rs762843285, rs267607226, rs1233603821, rs786205052
View all (1 more)
N/A
Kartagener Syndrome kartagener syndrome rs267607227, rs397515339 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Heterotaxia Heterotaxy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ciliary Motility Disorders Associate 19944405, 23122589, 25186273, 33174003
Congenital Abnormalities Associate 33174003
Infertility Associate 33174003
Nasopharyngeal Carcinoma Associate 31770211
Neural Tube Defects Associate 27543293