CEP20 (centrosomal protein 20)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 123811
Gene name Centrosomal protein 20
Gene symbol CEP20
Synonyms (NCBI Gene)
C16orf63FOPNLFOR20PHSECRG2
Chromosome 16
Chromosome location 16p13.11
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
Gene Gene ontology Other IDs Protein
Show/Hide all (25)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IBA
GO:0005813 Component Centrosome IDA 21399614
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
617149 26435 ENSG00000133393
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96NB1
Protein name Centrosomal protein 20 (FGFR1OP N-terminal-like protein) (FOP-related protein of 20 kDa) (LisH domain-containing protein FOPNL)
Protein function Involved in the biogenesis of cilia (PubMed:20551181). Required for the recruitment of PLK1 to centrosomes and S phase progression (PubMed:24018379).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09398 FOP_dimer 43 → 113 FOP N terminal dimerisation domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Detected in brain, heart, kidney, liver, lung, skeletal muscle, placenta and intestine. {ECO:0000269|PubMed:20551181}.
Sequence 
MATVAELKAVLKDTLEKKGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREY
LEFNKYKYTASVLIAESGQPVVPLDRQFLIHELNAFEESKDNTIPLLYGILAHFLRGTKD
GIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQAVNR
Sequence length 174
Interactions View interactions