Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1237
Gene name Gene Name - the full gene name approved by the HGNC.	C-C motif chemokine receptor 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCR8
Synonyms (NCBI Gene) Gene synonyms aliases	CC-CKR-8, CCR-8, CDw198, CKRL1, CMKBR8, CMKBRL2, CY6, GPRCY6, TER1
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the

Show/Hide all(6)

miRTarBase ID	miRNA	Experiments
MIRT1959112	hsa-miR-421	CLIP-seq
MIRT2677610	hsa-miR-129-5p	CLIP-seq
MIRT2677611	hsa-miR-205	CLIP-seq
MIRT2677612	hsa-miR-3978	CLIP-seq
MIRT2677613	hsa-miR-4539	CLIP-seq
MIRT2677614	hsa-miR-4728-3p	CLIP-seq

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	9417093
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8816377
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10910894
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	9670926
GO:0007155	Process	Cell adhesion	TAS	10910894
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	8816377
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	9417093
GO:0009897	Component	External side of plasma membrane	IBA
GO:0015026	Function	Coreceptor activity	TAS	9417093
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016493	Function	C-C chemokine receptor activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0060326	Process	Cell chemotaxis	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	IEA

MIM	HGNC	e!Ensembl
601834	1609	ENSG00000179934

Protein

UniProt ID

P51685

Protein name

C-C chemokine receptor type 8 (C-C CKR-8) (CC-CKR-8) (CCR-8) (CC chemokine receptor CHEMR1) (CMKBRL2) (Chemokine receptor-like 1) (CKR-L1) (GPR-CY6) (GPRCY6) (TER1) (CD antigen CDw198)

Protein function

Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection. {ECO:0000269|PubMed:10540332, ECO:0000269|PubMed:9207005, ECO:0000269|PubMed:94694

PDB

8KFX , 8KFY , 8KFZ , 8TLM , 8U1U , 8XML

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	52 → 300	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVL
VVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSS
MFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGV
LQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLV
LIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIY
AFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL

Sequence length

355

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Kaposi sarcoma-associated herpesvirus infection Viral carcinogenesis		Chemokine receptors bind chemokines G alpha (i) signalling events

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS

Show/Hide Text Mining Associations (42)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Asthma	Stimulate	20455898
Breast Neoplasms	Associate	27851913, 39273290
Carcinoma Hepatocellular	Associate	26813566, 36938723
Carcinoma Non Small Cell Lung	Associate	32884223
Carcinoma Renal Cell	Stimulate	23363815
Carcinoma Renal Cell	Associate	26716905
Central Nervous System Diseases	Associate	12547701
Cholangiocarcinoma	Associate	33045415
Colorectal Neoplasms	Associate	32884223, 33034614
Demyelinating Diseases	Associate	12547701
Dermatitis Atopic 1	Associate	11390417
Esophageal Squamous Cell Carcinoma	Associate	33460563
Gastrointestinal Stromal Tumors	Associate	32884223
Glioblastoma	Associate	35955670
HIV Infections	Associate	25421818
Infections	Associate	25421818
Inflammation	Associate	19208087, 23363815
Leukemia Lymphoma Adult T Cell	Associate	11493464
Leukoencephalopathy Progressive Multifocal	Associate	12547701
Lung Neoplasms	Associate	19309748
Lupus Erythematosus Systemic	Associate	26395317
Lymphoma B Cell Marginal Zone	Associate	22936065
Lymphoma Follicular	Associate	35887224
Lymphoma Large B Cell Diffuse	Stimulate	22936065
Lymphoma Large B Cell Diffuse	Associate	23640258, 35887224
Lymphoma Large Cell Anaplastic	Associate	25390351
Lymphoma Primary Cutaneous Anaplastic Large Cell	Stimulate	19710685
Melanoma Cutaneous Malignant	Associate	31983065
Mouth Neoplasms	Associate	34025655
Multiple Sclerosis	Associate	12547701
Neoplasms	Associate	23363815, 26716905, 26813566, 27851913, 27851914, 32367308, 32884223, 33460563, 33527196, 34025655, 37950246, 39273290, 40088713
Non Muscle Invasive Bladder Neoplasms	Associate	32367308
Ovarian Neoplasms	Associate	35186171, 37950246
Periodic fever familial autosomal dominant	Associate	32884223
Renal Insufficiency	Associate	28209402
Rhinitis Allergic	Associate	17982926
Sarcoma Kaposi	Associate	11518547
Squamous Cell Carcinoma of Head and Neck	Stimulate	34025655
Status Asthmaticus	Associate	11390417, 20455898
Tracheal Stenosis	Associate	37647429
Urinary Bladder Neoplasms	Associate	30592282
Vasculitis Leukocytoclastic Cutaneous	Associate	25390351

CCR8 (C-C motif chemokine receptor 8)