Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1235
Gene name Gene Name - the full gene name approved by the HGNC.	C-C motif chemokine receptor 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCR6
Synonyms (NCBI Gene) Gene synonyms aliases	BN-1, C-C CKR-6, CC-CKR-6, CCR-6, CD196, CKR-L3, CKRL3, CMKBR6, DCR2, DRY6, GPR29, GPRCY4, STRL22
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q27
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The gene is preferentially expressed by immature dendritic cells and memory T cells. The ligan

Show/Hide all(233)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029835	hsa-miR-26b-5p	Microarray	19088304
MIRT054540	hsa-miR-518a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR	24559209
MIRT054540	hsa-miR-518a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR	24559209
MIRT054540	hsa-miR-518a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR	24559209
MIRT054540	hsa-miR-518a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR	24559209
MIRT438120	hsa-miR-150-5p	ELISA, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24385540
MIRT438120	hsa-miR-150-5p	ELISA, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24385540
MIRT438120	hsa-miR-150-5p	ELISA, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24385540
MIRT438120	hsa-miR-150-5p	ELISA, Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	24385540
MIRT675085	hsa-miR-6514-5p	HITS-CLIP	23824327
MIRT675084	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT675083	hsa-miR-143-3p	HITS-CLIP	23824327
MIRT675082	hsa-miR-4770	HITS-CLIP	23824327
MIRT675081	hsa-miR-6088	HITS-CLIP	23824327
MIRT675080	hsa-miR-4708-5p	HITS-CLIP	23824327
MIRT675079	hsa-miR-1273f	HITS-CLIP	23824327
MIRT675078	hsa-miR-4534	HITS-CLIP	23824327
MIRT675077	hsa-miR-8082	HITS-CLIP	23824327
MIRT675076	hsa-miR-1289	HITS-CLIP	23824327
MIRT675075	hsa-miR-4294	HITS-CLIP	23824327
MIRT675074	hsa-miR-3198	HITS-CLIP	23824327
MIRT675073	hsa-miR-4309	HITS-CLIP	23824327
MIRT675072	hsa-miR-8055	HITS-CLIP	23824327
MIRT675071	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT663559	hsa-miR-1245a	HITS-CLIP	23824327
MIRT663560	hsa-miR-8079	HITS-CLIP	23824327
MIRT663558	hsa-miR-5579-3p	HITS-CLIP	23824327
MIRT663557	hsa-miR-640	HITS-CLIP	23824327
MIRT663556	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT663555	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT663554	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT663552	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT663553	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT663551	hsa-miR-3666	HITS-CLIP	23824327
MIRT663550	hsa-miR-4295	HITS-CLIP	23824327
MIRT663549	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT663548	hsa-miR-183-5p	HITS-CLIP	23824327
MIRT663547	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT663546	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT663545	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT663544	hsa-miR-3135b	HITS-CLIP	23824327
MIRT663543	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT663542	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT663541	hsa-miR-564	HITS-CLIP	23824327
MIRT663540	hsa-miR-3652	HITS-CLIP	23824327
MIRT663539	hsa-miR-4430	HITS-CLIP	23824327
MIRT663538	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT663537	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT497572	hsa-miR-4539	PAR-CLIP	22291592
MIRT497571	hsa-miR-4635	PAR-CLIP	22291592
MIRT497570	hsa-miR-3928-5p	PAR-CLIP	22291592
MIRT497569	hsa-miR-6806-3p	PAR-CLIP	22291592
MIRT497568	hsa-miR-4749-3p	PAR-CLIP	22291592
MIRT497567	hsa-miR-7843-3p	PAR-CLIP	22291592
MIRT497566	hsa-miR-127-5p	PAR-CLIP	22291592
MIRT731937	hsa-miR-150-3p	Western blot	27935859
MIRT731937	hsa-miR-150-3p	Western blot	27935859
MIRT675079	hsa-miR-1273f	HITS-CLIP	27418678
MIRT675079	hsa-miR-1273f	HITS-CLIP	27418678
MIRT675076	hsa-miR-1289	HITS-CLIP	27418678
MIRT675076	hsa-miR-1289	HITS-CLIP	27418678
MIRT675071	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT675071	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT675083	hsa-miR-143-3p	HITS-CLIP	27418678
MIRT675083	hsa-miR-143-3p	HITS-CLIP	27418678
MIRT675074	hsa-miR-3198	HITS-CLIP	27418678
MIRT675074	hsa-miR-3198	HITS-CLIP	27418678
MIRT675075	hsa-miR-4294	HITS-CLIP	27418678
MIRT675075	hsa-miR-4294	HITS-CLIP	27418678
MIRT675073	hsa-miR-4309	HITS-CLIP	27418678
MIRT675073	hsa-miR-4309	HITS-CLIP	27418678
MIRT675078	hsa-miR-4534	HITS-CLIP	27418678
MIRT675078	hsa-miR-4534	HITS-CLIP	27418678
MIRT675080	hsa-miR-4708-5p	HITS-CLIP	27418678
MIRT675080	hsa-miR-4708-5p	HITS-CLIP	27418678
MIRT675082	hsa-miR-4770	HITS-CLIP	27418678
MIRT675082	hsa-miR-4770	HITS-CLIP	27418678
MIRT675081	hsa-miR-6088	HITS-CLIP	27418678
MIRT675081	hsa-miR-6088	HITS-CLIP	27418678
MIRT675085	hsa-miR-6514-5p	HITS-CLIP	27418678
MIRT675085	hsa-miR-6514-5p	HITS-CLIP	27418678
MIRT663538	hsa-miR-6879-3p	HITS-CLIP	27418678
MIRT675072	hsa-miR-8055	HITS-CLIP	27418678
MIRT675072	hsa-miR-8055	HITS-CLIP	27418678
MIRT675077	hsa-miR-8082	HITS-CLIP	27418678
MIRT675077	hsa-miR-8082	HITS-CLIP	27418678
MIRT735791	hsa-miR-518a-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	32600091
MIRT675085	hsa-miR-6514-5p	HITS-CLIP	23824327
MIRT675084	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT675083	hsa-miR-143-3p	HITS-CLIP	23824327
MIRT675082	hsa-miR-4770	HITS-CLIP	23824327
MIRT675081	hsa-miR-6088	HITS-CLIP	23824327
MIRT675080	hsa-miR-4708-5p	HITS-CLIP	23824327
MIRT675079	hsa-miR-1273f	HITS-CLIP	23824327
MIRT675078	hsa-miR-4534	HITS-CLIP	23824327
MIRT675077	hsa-miR-8082	HITS-CLIP	23824327
MIRT675076	hsa-miR-1289	HITS-CLIP	23824327
MIRT675075	hsa-miR-4294	HITS-CLIP	23824327
MIRT675074	hsa-miR-3198	HITS-CLIP	23824327
MIRT675073	hsa-miR-4309	HITS-CLIP	23824327
MIRT675072	hsa-miR-8055	HITS-CLIP	23824327
MIRT675071	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT663559	hsa-miR-1245a	HITS-CLIP	23824327
MIRT663560	hsa-miR-8079	HITS-CLIP	23824327
MIRT663558	hsa-miR-5579-3p	HITS-CLIP	23824327
MIRT663557	hsa-miR-640	HITS-CLIP	23824327
MIRT663556	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT663555	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT663554	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT663552	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT663553	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT663551	hsa-miR-3666	HITS-CLIP	23824327
MIRT663550	hsa-miR-4295	HITS-CLIP	23824327
MIRT663549	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT663548	hsa-miR-183-5p	HITS-CLIP	23824327
MIRT663547	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT663546	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT663545	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT663544	hsa-miR-3135b	HITS-CLIP	23824327
MIRT663543	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT663542	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT663541	hsa-miR-564	HITS-CLIP	23824327
MIRT663540	hsa-miR-3652	HITS-CLIP	23824327
MIRT663539	hsa-miR-4430	HITS-CLIP	23824327
MIRT663538	hsa-miR-6879-3p	HITS-CLIP	23824327
MIRT663537	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT497572	hsa-miR-4539	PAR-CLIP	22291592
MIRT497571	hsa-miR-4635	PAR-CLIP	22291592
MIRT497570	hsa-miR-3928-5p	PAR-CLIP	22291592
MIRT497569	hsa-miR-6806-3p	PAR-CLIP	22291592
MIRT497568	hsa-miR-4749-3p	PAR-CLIP	22291592
MIRT497567	hsa-miR-7843-3p	PAR-CLIP	22291592
MIRT497566	hsa-miR-127-5p	PAR-CLIP	22291592
MIRT873250	hsa-miR-122	CLIP-seq
MIRT873251	hsa-miR-1245	CLIP-seq
MIRT873252	hsa-miR-1307	CLIP-seq
MIRT873253	hsa-miR-130a	CLIP-seq
MIRT873254	hsa-miR-130b	CLIP-seq
MIRT873255	hsa-miR-183	CLIP-seq
MIRT873256	hsa-miR-301a	CLIP-seq
MIRT873257	hsa-miR-301b	CLIP-seq
MIRT873258	hsa-miR-3149	CLIP-seq
MIRT873259	hsa-miR-371-5p	CLIP-seq
MIRT873260	hsa-miR-371b-5p	CLIP-seq
MIRT873261	hsa-miR-411	CLIP-seq
MIRT873262	hsa-miR-454	CLIP-seq
MIRT873263	hsa-miR-4729	CLIP-seq
MIRT873264	hsa-miR-548l	CLIP-seq
MIRT873265	hsa-miR-548n	CLIP-seq
MIRT873266	hsa-miR-720	CLIP-seq
MIRT873250	hsa-miR-122	CLIP-seq
MIRT873253	hsa-miR-130a	CLIP-seq
MIRT873254	hsa-miR-130b	CLIP-seq
MIRT873267	hsa-miR-150	CLIP-seq
MIRT873255	hsa-miR-183	CLIP-seq
MIRT873256	hsa-miR-301a	CLIP-seq
MIRT873257	hsa-miR-301b	CLIP-seq
MIRT873268	hsa-miR-3128	CLIP-seq
MIRT873269	hsa-miR-4258	CLIP-seq
MIRT873270	hsa-miR-4269	CLIP-seq
MIRT873271	hsa-miR-4438	CLIP-seq
MIRT873262	hsa-miR-454	CLIP-seq
MIRT873272	hsa-miR-5095	CLIP-seq
MIRT873273	hsa-miR-562	CLIP-seq
MIRT1959103	hsa-miR-3187-3p	CLIP-seq
MIRT1959104	hsa-miR-4435	CLIP-seq
MIRT1959105	hsa-miR-4701-5p	CLIP-seq
MIRT1959106	hsa-miR-4755-3p	CLIP-seq
MIRT1959107	hsa-miR-548s	CLIP-seq
MIRT1959108	hsa-miR-588	CLIP-seq
MIRT873250	hsa-miR-122	CLIP-seq
MIRT873252	hsa-miR-1307	CLIP-seq
MIRT873253	hsa-miR-130a	CLIP-seq
MIRT873254	hsa-miR-130b	CLIP-seq
MIRT1959109	hsa-miR-1343	CLIP-seq
MIRT873255	hsa-miR-183	CLIP-seq
MIRT873256	hsa-miR-301a	CLIP-seq
MIRT873257	hsa-miR-301b	CLIP-seq
MIRT1959110	hsa-miR-4284	CLIP-seq
MIRT873262	hsa-miR-454	CLIP-seq
MIRT1959111	hsa-miR-498	CLIP-seq
MIRT873250	hsa-miR-122	CLIP-seq
MIRT873252	hsa-miR-1307	CLIP-seq
MIRT873253	hsa-miR-130a	CLIP-seq
MIRT873254	hsa-miR-130b	CLIP-seq
MIRT1959109	hsa-miR-1343	CLIP-seq
MIRT873267	hsa-miR-150	CLIP-seq
MIRT873255	hsa-miR-183	CLIP-seq
MIRT873256	hsa-miR-301a	CLIP-seq
MIRT873257	hsa-miR-301b	CLIP-seq
MIRT2196035	hsa-miR-3152-5p	CLIP-seq
MIRT2196036	hsa-miR-377	CLIP-seq
MIRT1959110	hsa-miR-4284	CLIP-seq
MIRT873262	hsa-miR-454	CLIP-seq
MIRT2196037	hsa-miR-4641	CLIP-seq
MIRT2196038	hsa-miR-4690-3p	CLIP-seq
MIRT2196039	hsa-miR-4709-3p	CLIP-seq
MIRT2196040	hsa-miR-4731-5p	CLIP-seq
MIRT2196041	hsa-miR-4753-3p	CLIP-seq
MIRT2196042	hsa-miR-4772-3p	CLIP-seq
MIRT1959111	hsa-miR-498	CLIP-seq
MIRT873250	hsa-miR-122	CLIP-seq
MIRT873253	hsa-miR-130a	CLIP-seq
MIRT873254	hsa-miR-130b	CLIP-seq
MIRT2446537	hsa-miR-143	CLIP-seq
MIRT873256	hsa-miR-301a	CLIP-seq
MIRT873257	hsa-miR-301b	CLIP-seq
MIRT873262	hsa-miR-454	CLIP-seq
MIRT873266	hsa-miR-720	CLIP-seq
MIRT873250	hsa-miR-122	CLIP-seq
MIRT873252	hsa-miR-1307	CLIP-seq
MIRT873253	hsa-miR-130a	CLIP-seq
MIRT873254	hsa-miR-130b	CLIP-seq
MIRT1959109	hsa-miR-1343	CLIP-seq
MIRT873255	hsa-miR-183	CLIP-seq
MIRT873256	hsa-miR-301a	CLIP-seq
MIRT873257	hsa-miR-301b	CLIP-seq
MIRT2196035	hsa-miR-3152-5p	CLIP-seq
MIRT1959110	hsa-miR-4284	CLIP-seq
MIRT873262	hsa-miR-454	CLIP-seq
MIRT2196041	hsa-miR-4753-3p	CLIP-seq
MIRT2196042	hsa-miR-4772-3p	CLIP-seq
MIRT1959111	hsa-miR-498	CLIP-seq
MIRT873252	hsa-miR-1307	CLIP-seq
MIRT1959109	hsa-miR-1343	CLIP-seq
MIRT873267	hsa-miR-150	CLIP-seq
MIRT2196035	hsa-miR-3152-5p	CLIP-seq
MIRT1959110	hsa-miR-4284	CLIP-seq
MIRT873271	hsa-miR-4438	CLIP-seq
MIRT2196041	hsa-miR-4753-3p	CLIP-seq
MIRT1959111	hsa-miR-498	CLIP-seq
MIRT873272	hsa-miR-5095	CLIP-seq
MIRT873273	hsa-miR-562	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
NR3C2	Activation	11751947

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002407	Process	Dendritic cell chemotaxis	TAS	16621978
GO:0002523	Process	Leukocyte migration involved in inflammatory response	ISS
GO:0004950	Function	Chemokine receptor activity	TAS	11001880
GO:0005515	Function	Protein binding	IPI	20068036, 25122636
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9186513
GO:0006935	Process	Chemotaxis	IDA	20068036
GO:0006935	Process	Chemotaxis	IMP	12081481
GO:0006955	Process	Immune response	IBA	21873635
GO:0006959	Process	Humoral immune response	TAS	11001880
GO:0006968	Process	Cellular defense response	TAS	10521347
GO:0007165	Process	Signal transduction	TAS	9186513
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009986	Component	Cell surface	IDA	12081481
GO:0010634	Process	Positive regulation of epithelial cell migration	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA	21873635
GO:0016493	Function	C-C chemokine receptor activity	IDA	20068036
GO:0016493	Function	C-C chemokine receptor activity	IMP	12081481
GO:0019722	Process	Calcium-mediated signaling	IBA	21873635
GO:0019722	Process	Calcium-mediated signaling	IMP	12081481
GO:0019957	Function	C-C chemokine binding	IBA	21873635
GO:0019957	Function	C-C chemokine binding	IDA	20068036
GO:0019957	Function	C-C chemokine binding	IMP	12081481
GO:0036126	Component	Sperm flagellum	IDA	23765988
GO:0038023	Function	Signaling receptor activity	TAS	9186513
GO:0048290	Process	Isotype switching to IgA isotypes	ISS
GO:0060326	Process	Cell chemotaxis	IBA	21873635
GO:0060326	Process	Cell chemotaxis	IDA	23765988
GO:0060474	Process	Positive regulation of flagellated sperm motility involved in capacitation	IDA	23765988
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0072676	Process	Lymphocyte migration	ISS
GO:0072678	Process	T cell migration	ISS
GO:0072679	Process	Thymocyte migration	IBA	21873635
GO:0072679	Process	Thymocyte migration	ISS
GO:0097225	Component	Sperm midpiece	IDA	23765988
GO:0097228	Component	Sperm principal piece	IDA	23765988
GO:0097524	Component	Sperm plasma membrane	IDA	23765988
GO:1904155	Process	DN2 thymocyte differentiation	ISS
GO:1904156	Process	DN3 thymocyte differentiation	ISS
GO:2000404	Process	Regulation of T cell migration	ISS
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IBA	21873635

MIM	HGNC	e!Ensembl
601835	1607	ENSG00000112486

Protein

UniProt ID

P51684

Protein name

C-C chemokine receptor type 6 (C-C CKR-6) (CC-CKR-6) (CCR-6) (Chemokine receptor-like 3) (CKR-L3) (DRY6) (G-protein coupled receptor 29) (GPR-CY4) (GPRCY4) (LARC receptor) (CD antigen CD196)

Protein function

Receptor for the C-C type chemokine CCL20 (PubMed:9169459). Binds to CCL20 and subsequently transduces a signal by increasing the intracellular calcium ion levels (PubMed:20068036). Although CCL20 is its major ligand it can also act as a recepto

PDB

6WWZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	63 → 316	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Sperm. Mainly localized in the tail and in the postacrosomal region but is also found in the midpiece and basal region in a small percentage of sperm cells. Reduced levels found in the sperms of asthenozoospermia and leukocytospermia p

Sequence

MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFG
LLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKL
LKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISS
STFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKT
LVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAANLGKMNRSCQSEKLIGYTKTV
TEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQT
SETADNDNASSFTM

Sequence length

374

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway		Beta defensins Chemokine receptors bind chemokines G alpha (i) signalling events

Show/Hide Causal Diseases (7)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Autoimmune diseases	Autoimmune Diseases	rs869025224	21383967
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	22190364
Pulmonary arterial hypertension	Pulmonary arterial hypertension, Idiopathic pulmonary arterial hypertension	rs121909288, rs137852741, rs137852742, rs137852743, rs137852744, rs137852745, rs137852746, rs137852748, rs137852749, rs137852750, rs137852751, rs137852753, rs863223423, rs863223426, rs863223424 View all (116 more)
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578 View all (1 more)
Renal insufficiency	Renal Insufficiency	rs1596536873
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	23143596, 20453841, 24532676, 24390342, 20453842, 24782177, 22446963, 30423114

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Asthma	Asthma	26031901	ClinVar
Congestive heart failure	Congestive heart failure		ClinVar
Biliary Cholangitis	Biliary Cholangitis		GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease		GWAS

Show/Hide Text Mining Associations (155)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Habitual	Inhibit	26345847
Adenocarcinoma of Lung	Associate	20872189, 35437508
Adenoma	Stimulate	23790181
AIDS Associated Nephropathy	Associate	31796951
Alzheimer Disease	Stimulate	23824053
Anemia	Associate	16413387
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Inhibit	34289887
Aortic Aneurysm Abdominal	Associate	29229985
Arthralgia	Associate	37280058
Arthritis	Associate	37280058
Arthritis Psoriatic	Associate	24286492, 31677365, 34681660
Arthritis Psoriatic	Stimulate	31350460
Arthritis Rheumatoid	Associate	11472439, 12695561, 16207316, 19804625, 21204897, 22092173, 22127930, 22355377, 23577190, 23983073, 25430993, 26617177, 27595364, 27626929, 27822475 View all (5 more)
Arthritis Rheumatoid	Stimulate	33362761, 35095831, 38156398
Asthma	Associate	18422729
Atrophy	Associate	33717080
Autoimmune Diseases	Associate	24890729, 25972006, 28336414, 28710773, 33547171
Autoimmune Diseases of the Nervous System	Associate	18422729, 25972006
Bone Marrow Failure Disorders	Associate	16413387
Bone Resorption	Associate	27822475
Breast Neoplasms	Associate	21624121, 26942414, 35754051
Bronchiolitis Obliterans Syndrome	Associate	26717145, 27758874
Carcinogenesis	Associate	17075975, 24602001
Carcinoma Hepatocellular	Inhibit	15180734
Carcinoma Hepatocellular	Associate	16764701, 17075975, 21935436, 22615204, 24743888, 26331965, 30633620, 31322256, 36938723
Carcinoma Non Small Cell Lung	Associate	21949768, 36657812, 37316552
Carcinoma Pancreatic Ductal	Stimulate	20976171
Carcinoma Pancreatic Ductal	Associate	31432181
Carcinoma Renal Cell	Associate	23578198, 32775427
Celiac Disease	Associate	26859134
Cholangiocarcinoma	Associate	33045415
Cholangitis Sclerosing	Associate	28383652
Chorioamnionitis	Associate	27870827
Colitis Ulcerative	Associate	26536229, 30347808
Colitis Ulcerative	Stimulate	31191543, 31660620
Colonic Neoplasms	Associate	23790181
Colorectal Neoplasms	Associate	16641550, 23790181, 24559209, 27149649, 29268566
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	16413387
COVID 19	Associate	33768543, 36146713, 37827267
COVID 19	Stimulate	35688805
Crohn Disease	Associate	26536229
Crohn Disease	Stimulate	31191543
Depressive Disorder Major	Associate	24618828
Dermatomyositis	Associate	14730617
Diabetes Mellitus Type 1	Associate	30723474
Encephalitis	Associate	32109548
Encephalomyelitis Autoimmune Experimental	Associate	28336414
Erdheim Chester Disease	Associate	17133532
Esophageal Neoplasms	Associate	38016720
Esophageal Squamous Cell Carcinoma	Associate	38016720
Fibrocartilaginous embolism	Associate	23823618
Fibrosis	Associate	33717080
Gastritis	Associate	19006683
Gastrointestinal Neoplasms	Associate	20459729
Geographic Atrophy	Associate	38165703
Glomerulonephritis IGA	Associate	33462083, 33717080
Glycosuria Renal	Associate	34289887
Graft vs Host Disease	Associate	23226545
Granulomatosis with Polyangiitis	Stimulate	22490506
Granulomatosis with Polyangiitis	Associate	28615072
Graves Disease	Associate	25928629, 30956992
Helicobacter Infections	Associate	34795977
Hepatitis C	Associate	28387899, 31652598
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30206415
Hereditary leiomyomatosis and renal cell cancer	Associate	18684866
Histiocytosis Langerhans Cell	Associate	12642342
Histiocytosis Sinus	Associate	12642342
HIV Infections	Associate	17197436, 24009735, 25894562, 26807971, 26883727, 27203285, 28509877, 31796951, 35418589, 39178742
HIV Infections	Stimulate	29048352
Idiopathic Pulmonary Fibrosis	Associate	22037258
IgA Vasculitis	Associate	11762935
Immune Reconstitution Inflammatory Syndrome	Associate	30728405
Immune System Diseases	Associate	23935994, 25928629, 33717080
Infections	Associate	17197436, 20023216, 24009735
Inflammation	Associate	12197893, 16179368, 17562763, 19208087, 20844183, 22037258, 24313359, 26536229, 28387899, 30972071, 31379807, 32109548, 33158438, 33888832, 34082814
Inflammation	Inhibit	30347808
Inflammatory Bowel Disease 20	Associate	31852159
Inflammatory Bowel Diseases	Associate	18422729, 26536229
Intervertebral Disc Degeneration	Associate	34191345
Intervertebral disc disease	Associate	23823618
Intestinal Perforation	Inhibit	36825028
Kidney Failure Chronic	Stimulate	29868028
Leukemia B Cell	Associate	20839337
Leukemia Lymphocytic Chronic B Cell	Associate	27302925
Leukemia Myelomonocytic Acute	Associate	12829025
Leukemia Prolymphocytic T Cell	Associate	20839337
Lung Injury	Associate	37827267
Lung Neoplasms	Associate	19309748
Lupus Erythematosus Systemic	Associate	20334681, 24598455
Lupus Erythematosus Systemic	Inhibit	34940981
Lymphohistiocytosis Hemophagocytic	Associate	12642342
Lymphoma	Associate	29293620
Lymphoma B Cell Marginal Zone	Associate	24602001, 29674500, 32300208, 35142152
Lymphoma Follicular	Associate	24602001
Lymphoma Large B Cell Diffuse	Associate	32600091, 34039950
Lymphoma Large Cell Anaplastic	Associate	30206415
Lymphoma T Cell Peripheral	Associate	18842429
Melanoma	Associate	20220766
Melanoma Cutaneous Malignant	Associate	31983065
Meningioma	Associate	20406964
Mouth Diseases	Associate	35142152
Mouth Neoplasms	Associate	38044583
Multiple Sclerosis	Associate	25972006, 28336414, 30698680, 33037101, 33158438, 34006899, 36250467
Myasthenia Gravis	Associate	26826242
Neoplasm Metastasis	Associate	16627550, 17075975, 19324905, 21912453, 23790181, 27149649, 29268566
Neoplasm Metastasis	Stimulate	16641550
Neoplasms	Associate	16283305, 16641550, 16764701, 17075975, 18441394, 19324905, 19340288, 20220766, 20872189, 20969772, 21085979, 21624121, 21935436, 22699780, 24743888 View all (11 more)
Neoplasms	Stimulate	27149649
Obesity	Associate	28903065
Osteoarthritis	Associate	26866940
Osteoarthritis	Stimulate	33362761
Osteoporosis	Associate	27822475
Ovarian Neoplasms	Associate	31866467
Pain	Associate	34191345
Pancreatic Neoplasms	Associate	20459729
Pancreatitis Chronic	Associate	34702715
Peptic Ulcer	Associate	33331471, 34795977
Periodontal Diseases	Associate	12067311
Periodontitis	Associate	30944162
Personality Disorders	Associate	21624121
Polyendocrinopathies Autoimmune	Inhibit	20500699
Polymyositis	Associate	14730617
Prostatic Neoplasms	Associate	28903065, 36045408, 36479732
Prostatitis	Associate	21949768
Psoriasis	Associate	20943046, 25202827
Psoriasis	Stimulate	24286492
Pulmonary Embolism	Associate	35572511
Purpura Thrombocytopenic Idiopathic	Associate	30403287
Rectal Neoplasms	Associate	29268566
Renal Insufficiency	Associate	28209402
Sarcoidosis	Associate	27230441, 35075176
Sarcoma Kaposi	Stimulate	19324905
Schizophrenia	Associate	32109548
Scleroderma Systemic	Associate	21996293, 23983073
Sjogren's Syndrome	Associate	29453859
Smoke Inhalation Injury	Associate	32300208, 37316552
Spinal Cord Injuries	Associate	38139422
Squamous Cell Carcinoma of Head and Neck	Associate	36326893
Status Asthmaticus	Associate	18422729
Stomach Diseases	Associate	17562763
Stomach Neoplasms	Associate	39781526
Tachycardia Atrioventricular Nodal Reentry	Associate	27149649
Takayasu Arteritis	Stimulate	33538119
Thyroid Neoplasms	Associate	26577851
Thyroiditis Autoimmune	Associate	25928629
Trigeminal Neuralgia	Associate	34067581
Tuberculosis	Stimulate	18052967
Tuberculosis	Associate	30728405
Ulcer	Associate	34795977
Uterine Cervical Neoplasms	Associate	25768730, 26156805
Uterine Cervical Neoplasms	Inhibit	33888832
Uterine Cervicitis	Associate	33888832
Uveomeningoencephalitic Syndrome	Associate	23935994
Vascular Diseases	Associate	35572511
Vitiligo	Associate	20526340

CCR6 (C-C motif chemokine receptor 6)