SLC51B (SLC51 subunit beta)

Gene

• Entrez ID: 123264
• Gene name: SLC51 subunit beta
• Gene symbol: SLC51B
• Synonyms (NCBI Gene): OSTB, OSTBETA, PBAM2, SLC51A1BP
• Disease Acronyms (UniProt): PBAM2
• Chromosome: 15
• Chromosome location: 15q22.31

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005215	Function	Transporter activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	12719432
GO:0015125	Function	Bile acid transmembrane transporter activity	IEA
GO:0015721	Process	Bile acid and bile salt transport	IBA	21873635
GO:0015721	Process	Bile acid and bile salt transport	ISS
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0016021	Component	Integral component of membrane	ISS
GO:0016323	Component	Basolateral plasma membrane	IDA	16317684
GO:0031647	Process	Regulation of protein stability	ISS
GO:0032782	Process	Bile acid secretion	IPI	16317684
GO:0032991	Component	Protein-containing complex	IBA	21873635
GO:0032991	Component	Protein-containing complex	ISS
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0060050	Process	Positive regulation of protein glycosylation	ISS
GO:0070863	Process	Positive regulation of protein exit from endoplasmic reticulum	ISS
GO:0090314	Process	Positive regulation of protein targeting to membrane	ISS

Other IDs

• MIM: 612085
• HGNC: 29956
• e!Ensembl: ENSG00000186198

Protein

• UniProt ID: Q86UW2
• Protein name: Organic solute transporter subunit beta (OST-beta) (Solute carrier family 51 subunit beta)
• Protein function: Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood (PubMed:16317684). Modulates SLC51A glycosylation, membr
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15048	OSTbeta	3 → 122	Organic solute transporter subunit beta protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with a high expression in ileum. Expressed in testis, colon, liver, small intestine, kidney, ovary and adrenal gland; and at low levels in heart, lung, brain, pituitary, thyroid gland, uterus, prostate, mammary gland a
• Sequence:

  MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQ
  ASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFL
  PDVPETES

• Sequence length: 128

Pathways

KEGG:

Bile secretion

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Cholestasis	Cholestasis	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039	16423920, 22461449

Unknown
Disease term	Disease name	Evidence	References	Source
Bile Acid Malabsorption	bile acid malabsorption, primary, 2			GenCC

Associations from Text Mining
Disease Name	Relationship Type	References
Bile Acid Malabsorption Primary	Associate	28898457
Carcinoma Hepatocellular	Associate	34128989, 35592684
Chemical and Drug Induced Liver Injury	Associate	29420067, 34599072
Cholangitis Sclerosing	Associate	28008998
Cholelithiasis	Associate	18469300
Cholestasis	Associate	25798860, 29420067, 34599072
Diarrhea	Associate	28898457
Endometrial Neoplasms	Inhibit	33917029
Gallstones	Associate	18469300
Liver Cirrhosis Biliary	Associate	29420067
Liver Failure	Associate	25798860, 29420067
Lymphoma Large B Cell Diffuse	Associate	37141112
Neoplasms	Associate	37141112
Non alcoholic Fatty Liver Disease	Stimulate	29420067