Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	123264
Gene name Gene Name - the full gene name approved by the HGNC.	SLC51 subunit beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC51B
Synonyms (NCBI Gene) Gene synonyms aliases	OSTB, OSTBETA, PBAM2, SLC51A1BP
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q22.31

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IDA	12719432
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006869	Process	Lipid transport	IEA
GO:0015125	Function	Bile acid transmembrane transporter activity	IBA
GO:0015125	Function	Bile acid transmembrane transporter activity	IEA
GO:0015721	Process	Bile acid and bile salt transport	IBA
GO:0015721	Process	Bile acid and bile salt transport	IEA
GO:0015721	Process	Bile acid and bile salt transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IDA	16317684
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031647	Process	Regulation of protein stability	ISS
GO:0032782	Process	Bile acid secretion	IBA
GO:0032782	Process	Bile acid secretion	IPI	16317684
GO:0032991	Component	Protein-containing complex	IBA
GO:0032991	Component	Protein-containing complex	IEA
GO:0032991	Component	Protein-containing complex	ISS
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0060050	Process	Positive regulation of protein glycosylation	IEA
GO:0060050	Process	Positive regulation of protein glycosylation	ISS
GO:0070863	Process	Positive regulation of protein exit from endoplasmic reticulum	IEA
GO:0070863	Process	Positive regulation of protein exit from endoplasmic reticulum	ISS
GO:0090314	Process	Positive regulation of protein targeting to membrane	IEA
GO:0090314	Process	Positive regulation of protein targeting to membrane	ISS

MIM	HGNC	e!Ensembl
612085	29956	ENSG00000186198

Protein

UniProt ID

Q86UW2

Protein name

Organic solute transporter subunit beta (OST-beta) (Solute carrier family 51 subunit beta)

Protein function

Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood (PubMed:16317684). Modulates SLC51A glycosylation, membr

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15048	OSTbeta	3 → 122	Organic solute transporter subunit beta protein	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with a high expression in ileum. Expressed in testis, colon, liver, small intestine, kidney, ovary and adrenal gland; and at low levels in heart, lung, brain, pituitary, thyroid gland, uterus, prostate, mammary gland a

Sequence

MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQ
ASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFL
PDVPETES

Sequence length

128

Interactions

View interactions

	KEGG
	Bile secretion

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bile Acid Malabsorption	bile acid malabsorption, primary, 2	N/A	N/A	GenCC

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Bile Acid Malabsorption Primary	Associate	28898457
Carcinoma Hepatocellular	Associate	34128989, 35592684
Chemical and Drug Induced Liver Injury	Associate	29420067, 34599072
Cholangitis Sclerosing	Associate	28008998
Cholelithiasis	Associate	18469300
Cholestasis	Associate	25798860, 29420067, 34599072
Diarrhea	Associate	28898457
Endometrial Neoplasms	Inhibit	33917029
Gallstones	Associate	18469300
Liver Cirrhosis Biliary	Associate	29420067
Liver Failure	Associate	25798860, 29420067
Lymphoma Large B Cell Diffuse	Associate	37141112
Neoplasms	Associate	37141112
Non alcoholic Fatty Liver Disease	Stimulate	29420067

SLC51B (SLC51 subunit beta)