Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
123263
Gene name Gene Name - the full gene name approved by the HGNC.
Mitochondrial methionyl-tRNA formyltransferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MTFMT
Synonyms (NCBI Gene) Gene synonyms aliases
COXPD15, FMT1, MC1DN27
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q22.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this nuclear gene localizes to the mitochondrion, where it catalyzes the formylation of methionyl-tRNA. [provided by RefSeq, Jun 2011]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs199599204 G>A,C,T Conflicting-interpretations-of-pathogenicity, benign-likely-benign, benign Coding sequence variant, missense variant, non coding transcript variant, synonymous variant
rs200286768 G>A,T Pathogenic Coding sequence variant, genic downstream transcript variant, synonymous variant, stop gained
rs201431517 G>A Pathogenic-likely-pathogenic, pathogenic Coding sequence variant, missense variant, intron variant
rs372732702 C>A,T Likely-pathogenic Coding sequence variant, missense variant, non coding transcript variant, synonymous variant
rs397514613 G>A Pathogenic Coding sequence variant, non coding transcript variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020872 hsa-miR-155-5p Proteomics 18668040
MIRT036679 hsa-miR-935 CLASH 23622248
MIRT696763 hsa-miR-3974 HITS-CLIP 23313552
MIRT696762 hsa-miR-624-3p HITS-CLIP 23313552
MIRT696761 hsa-miR-4293 HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003824 Function Catalytic activity IEA
GO:0004479 Function Methionyl-tRNA formyltransferase activity IBA
GO:0004479 Function Methionyl-tRNA formyltransferase activity IDA 25288793
GO:0004479 Function Methionyl-tRNA formyltransferase activity IEA
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611766 29666 ENSG00000103707
Protein
UniProt ID Q96DP5
Protein name Methionyl-tRNA formyltransferase, mitochondrial (MtFMT) (EC 2.1.2.9)
Protein function Methionyl-tRNA formyltransferase that formylates methionyl-tRNA in mitochondria and is crucial for translation initiation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00551 Formyl_trans_N 97 220 Formyl transferase Domain
PF02911 Formyl_trans_C 243 350 Formyl transferase, C-terminal domain Domain
Sequence
MRVLVRRCWGPPLAHGARRGRPSPQWRALARLGWEDCRDSRVREKPPWRVLFFGTDQFAR
EALRALHAARENKEEELIDKLEVVTMPSPSPKGLPVKQYAVQSQLPVYEWPDVGSGEYDV
GVVASFGRLLNEALILKFPYGILNVHPSCLPRWRGPAPVIHTVLHGDTVTGVTIMQIRPK
RFDVGPILKQETVPVPPKSTAKELEAVLSRLGANMLISVL
KNLPESLSNGRQQPMEGATY
APKISAGTSCIKWEEQTSEQIFRLYRAIGNIIPLQTLWMANTIKLLDLVEVNSSVLADPK
LTGQALIPGSVIYHKQSQILLVYCKDGWIGVRSVMLKKSLTATDFYNGYL
HPWYQKNSQA
QPSQCRFQTLRLPTKKKQKKTVAMQQCIE
Sequence length 389
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Aminoacyl-tRNA biosynthesis
Metabolic pathways
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Combined Oxidative Phosphorylation Deficiency combined oxidative phosphorylation defect type 15 rs397514613, rs397514614, rs200286768, rs587777244, rs587777417, rs587777418, rs587777419, rs863224897, rs777725264, rs201431517, rs1555404423 N/A
leigh syndrome Leigh syndrome rs201431517 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Leigh Syndrome With Leukodystrophy Leigh syndrome with leukodystrophy N/A N/A GenCC
Microcephaly microcephaly N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Basal Ganglia Diseases Associate 30911575
Brain Stem Neoplasms Associate 30911575
Cardiomyopathies Associate 25911677
Colorectal Neoplasms Associate 36299603
CoQ responsive OXPHOS deficiency Associate 21907147
Leigh Disease Associate 21907147, 23499752, 25911677, 30911575
Leukoencephalopathies Associate 30911575
Mitochondrial Diseases Associate 23499752, 25735936, 30911575