CCR3 (C-C motif chemokine receptor 3)

Gene

• Entrez ID: 1232
• Gene name: C-C motif chemokine receptor 3
• Gene symbol: CCR3
• Synonyms (NCBI Gene): C C CKR3, CC-CKR-3, CD193, CKR 3, CKR3, CMKBR3
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT873213	hsa-miR-3163	CLIP-seq
MIRT873214	hsa-miR-3622a-5p	CLIP-seq
MIRT873215	hsa-miR-4423-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA1	Unknown	22217447
NFKB1	Activation	16604092
RELA	Activation	16604092

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	10415069
GO:0005515	Function	Protein binding	IPI	23597562
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IDA	18587271
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9302298
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10201960
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	9302298
GO:0006955	Process	Immune response	IBA
GO:0006968	Process	Cellular defense response	TAS	10713092
GO:0007155	Process	Cell adhesion	TAS	10201960
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	10201960
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	9302298
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016493	Function	C-C chemokine receptor activity	IDA	35570218
GO:0016493	Function	C-C chemokine receptor activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0019957	Function	C-C chemokine binding	IDA	11425309
GO:0019957	Function	C-C chemokine binding	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IMP	19525930
GO:0060326	Process	Cell chemotaxis	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	35570218
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	10587439, 19525930
GO:0071345	Process	Cellular response to cytokine stimulus	IEA

Other IDs

• MIM: 601268
• HGNC: 1604
• e!Ensembl: ENSG00000183625

Protein

• UniProt ID: P51677
• Protein name: C-C chemokine receptor type 3 (C C CKR3) (C-C CKR-3) (CC-CKR-3) (CCR-3) (CCR3) (CKR 3) (CKR3) (Eosinophil eotaxin receptor) (CD antigen CD193)
• Protein function: Receptor for C-C type chemokine. Binds and responds to a variety of chemokines, including CCL11, CCL26, CCL7, CCL13, RANTES(CCL5) and CCL15 (PubMed:7622448, PubMed:8642344, PubMed:8676064). Subsequently transduces a signal by increasing the intr
• PDB: 7X9Y
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	51 → 301	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: In eosinophils as well as trace amounts in neutrophils and monocytes. {ECO:0000269|PubMed:8676064}.
• Sequence:

  MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI
  KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE
  IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE
  TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL
  IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI
  YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF

• Sequence length: 355

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Human cytomegalovirus infection
Kaposi sarcoma-associated herpesvirus infection
Viral carcinogenesis

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events