Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1230
Gene name Gene Name - the full gene name approved by the HGNC.	C-C motif chemokine receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CCR1
Synonyms (NCBI Gene) Gene synonyms aliases	CD191, CKR-1, CKR1, CMKBR1, HM145, MIP1aR, SCYAR1
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), re

Show/Hide all(56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005956	hsa-miR-21-5p	Luciferase reporter assay	21131358
MIRT733201	hsa-miR-191-5p	ELISA, qRT-PCR, Western blotting	33420627
MIRT873169	hsa-miR-1207-5p	CLIP-seq
MIRT873170	hsa-miR-1208	CLIP-seq
MIRT873171	hsa-miR-1254	CLIP-seq
MIRT873172	hsa-miR-1289	CLIP-seq
MIRT873173	hsa-miR-135a	CLIP-seq
MIRT873174	hsa-miR-135b	CLIP-seq
MIRT873175	hsa-miR-197	CLIP-seq
MIRT873176	hsa-miR-3065-5p	CLIP-seq
MIRT873177	hsa-miR-3116	CLIP-seq
MIRT873178	hsa-miR-3190	CLIP-seq
MIRT873179	hsa-miR-3198	CLIP-seq
MIRT873180	hsa-miR-34b	CLIP-seq
MIRT873181	hsa-miR-34c-3p	CLIP-seq
MIRT873182	hsa-miR-3653	CLIP-seq
MIRT873183	hsa-miR-3658	CLIP-seq
MIRT873184	hsa-miR-3940-5p	CLIP-seq
MIRT873185	hsa-miR-4294	CLIP-seq
MIRT873186	hsa-miR-4302	CLIP-seq
MIRT873187	hsa-miR-4309	CLIP-seq
MIRT873188	hsa-miR-4318	CLIP-seq
MIRT873189	hsa-miR-4507	CLIP-seq
MIRT873190	hsa-miR-4704-3p	CLIP-seq
MIRT873191	hsa-miR-4736	CLIP-seq
MIRT873192	hsa-miR-4757-5p	CLIP-seq
MIRT873193	hsa-miR-4763-3p	CLIP-seq
MIRT873194	hsa-miR-4790-3p	CLIP-seq
MIRT873195	hsa-miR-487a	CLIP-seq
MIRT873196	hsa-miR-501-3p	CLIP-seq
MIRT873197	hsa-miR-502-3p	CLIP-seq
MIRT873198	hsa-miR-550a	CLIP-seq
MIRT873199	hsa-miR-648	CLIP-seq
MIRT873200	hsa-miR-661	CLIP-seq
MIRT873201	hsa-miR-759	CLIP-seq
MIRT1959076	hsa-miR-3170	CLIP-seq
MIRT1959077	hsa-miR-4323	CLIP-seq
MIRT2196016	hsa-miR-134	CLIP-seq
MIRT2196017	hsa-miR-223	CLIP-seq
MIRT2196018	hsa-miR-3118	CLIP-seq
MIRT2196019	hsa-miR-3164	CLIP-seq
MIRT873186	hsa-miR-4302	CLIP-seq
MIRT2196020	hsa-miR-4687-3p	CLIP-seq
MIRT2196021	hsa-miR-4697-3p	CLIP-seq
MIRT2677602	hsa-miR-1227	CLIP-seq
MIRT2196016	hsa-miR-134	CLIP-seq
MIRT2677603	hsa-miR-3064-5p	CLIP-seq
MIRT2196018	hsa-miR-3118	CLIP-seq
MIRT2196019	hsa-miR-3164	CLIP-seq
MIRT2677604	hsa-miR-3652	CLIP-seq
MIRT1959077	hsa-miR-4323	CLIP-seq
MIRT2677605	hsa-miR-4430	CLIP-seq
MIRT2677606	hsa-miR-4480	CLIP-seq
MIRT2677607	hsa-miR-4505	CLIP-seq
MIRT2677608	hsa-miR-4786-3p	CLIP-seq
MIRT2677609	hsa-miR-490-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
STAT1	Activation	16628196

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002407	Process	Dendritic cell chemotaxis	TAS	16621978
GO:0004435	Function	Phosphatidylinositol phospholipase C activity	IDA	10734056
GO:0004950	Function	Chemokine receptor activity	IDA	10660125
GO:0005515	Function	Protein binding	IPI	8699119, 15001559, 15474493, 28298427, 28381538, 32296183
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	10660125, 15474493, 18587271
GO:0005886	Component	Plasma membrane	IMP	15001559
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	7505609
GO:0006816	Process	Calcium ion transport	IDA	10734056
GO:0006874	Process	Cellular calcium ion homeostasis	IDA	10734056
GO:0006887	Process	Exocytosis	IDA	10734056
GO:0006935	Process	Chemotaxis	NAS	15474493
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006955	Process	Immune response	IBA	21873635
GO:0006955	Process	Immune response	IDA	10734056
GO:0007155	Process	Cell adhesion	TAS	10910894
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10770925
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	7505609
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	10734056
GO:0007267	Process	Cell-cell signaling	IDA	10734056
GO:0009611	Process	Response to wounding	TAS	7505609
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IDA	10706735
GO:0010629	Process	Negative regulation of gene expression	IMP	21403648
GO:0016493	Function	C-C chemokine receptor activity	IBA	21873635
GO:0016493	Function	C-C chemokine receptor activity	IDA	10734056
GO:0019221	Process	Cytokine-mediated signaling pathway	NAS	15474493
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019722	Process	Calcium-mediated signaling	IBA	21873635
GO:0019957	Function	C-C chemokine binding	IBA	21873635
GO:0019957	Function	C-C chemokine binding	IPI	7545673, 8699119, 10660125, 15764707
GO:0030335	Process	Positive regulation of cell migration	IMP	24056371
GO:0030502	Process	Negative regulation of bone mineralization	IMP	21403648
GO:0035717	Function	Chemokine (C-C motif) ligand 7 binding	IBA	21873635
GO:0035717	Function	Chemokine (C-C motif) ligand 7 binding	IPI	7545673, 10660125
GO:0045672	Process	Positive regulation of osteoclast differentiation	IMP	21403648
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	15764707
GO:0060326	Process	Cell chemotaxis	IBA	21873635
GO:0070098	Process	Chemokine-mediated signaling pathway	IDA	21403648
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	21403648
GO:0071791	Function	Chemokine (C-C motif) ligand 5 binding	IBA	21873635
GO:0071791	Function	Chemokine (C-C motif) ligand 5 binding	IPI	7545673, 8699119, 10660125, 10734056
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	18587271

MIM	HGNC	e!Ensembl
601159	1602	ENSG00000163823

Protein

UniProt ID

P32246

Protein name

C-C chemokine receptor type 1 (C-C CKR-1) (CC-CKR-1) (CCR-1) (CCR1) (HM145) (LD78 receptor) (Macrophage inflammatory protein 1-alpha receptor) (MIP-1alpha-R) (RANTES-R) (CD antigen CD191)

Protein function

Chemokine receptor that plays a crucial role in regulating immune cell migration, inflammation, and immune responses (PubMed:14991608). Contributes to the inflammatory response by recruiting immune cells, such as monocytes, macrophages, T-cells,

PDB

7VL8 , 7VL9 , 7VLA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	51 → 301	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in different hematopoietic cells.

Sequence

METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF

Sequence length

355

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection		Chemokine receptors bind chemokines G alpha (i) signalling events Interleukin-10 signaling

Show/Hide Causal Diseases (8)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Behcet syndrome	Behcet Syndrome, Beh�et disease	rs886040969, rs886039866, rs746055479, rs752615209, rs774164456, rs751454741	23291587, 26097239
Cataract	Cataract	rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322 View all (150 more)
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174
Developmental regression	Developmental regression	rs1224421127
Migraine	Migraine Disorders	rs794727411
Renal insufficiency	Renal Insufficiency	rs1596536873
Vasculitis	Vasculitis	rs376785840, rs587777240, rs200930463, rs587777241, rs77563738, rs202134424, rs148936893, rs587777242, rs775440641, rs770689762, rs45511697, rs139750129, rs756881285, rs747774101, rs1568966771 View all (6 more)

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Myocardial infarction	Myocardial Infarction	ClinVar
Pancreatitis	Pancreatitis	ClinVar

Show/Hide Text Mining Associations (111)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	32509861
Albinism with hemorrhagic diathesis and pigmented reticuloendothelial cells	Stimulate	19729668
Alzheimer Disease	Stimulate	22801742
Androgen Insensitivity Syndrome	Associate	34867780
Arthritis	Associate	16107514, 28619088
Arthritis	Stimulate	29880013
Arthritis Rheumatoid	Associate	11352233, 12909630, 15548526, 31554310
Ascites	Associate	17926037
Asthma	Associate	15548526, 18178867
Atherosclerosis	Associate	32787365, 35287505, 38277520
Autism Spectrum Disorder	Stimulate	37108638
Behcet Syndrome	Associate	29895319
Bipolar Disorder	Associate	25487697
Bone Diseases	Stimulate	15730850
Breast Neoplasms	Associate	16518599, 29685151
Burkitt Lymphoma	Associate	35408790
Carcinoma Hepatocellular	Associate	12651617, 26501423, 29285854, 34050704, 38274805, 38552222
Carcinoma Ovarian Epithelial	Associate	17926037
Carotid Artery Diseases	Associate	34140767
Cartilage Diseases	Associate	11465714
Cerebral Infarction	Associate	38277520
Cholangiocarcinoma	Associate	33045415
Ciliary Motility Disorders	Associate	29116124
Clinical Deterioration	Stimulate	25997515
Colitis Ulcerative	Inhibit	31842582
Colitis Ulcerative	Associate	37055495
Colorectal Neoplasms	Associate	35715847
Conjunctivitis Allergic	Associate	11673306
Coronary Artery Disease	Associate	12742282
COVID 19	Associate	33138195, 33260035, 34239034, 35172892, 37001702
COVID 19	Inhibit	36433939
Critical Illness	Stimulate	32360286
Crohn Disease	Associate	29556615
Diabetic Nephropathies	Associate	38206700
Drug Hypersensitivity	Associate	37861500
Endometriosis	Associate	15950672, 17261287
Epilepsy	Associate	23418513
Epstein Barr Virus Infections	Stimulate	28892735
Familial Primary Pulmonary Hypertension	Associate	33478117
Gastritis	Associate	36973348
GATA2 Deficiency	Associate	37798178
Glomerulosclerosis Focal Segmental	Associate	35693262
Graft vs Host Disease	Stimulate	15812393
Granulomatous Disease Chronic	Associate	14688376
Heart Diseases	Associate	32967511
Heart Failure	Associate	32967511
HIV Infections	Stimulate	12621126
Hodgkin Disease	Associate	20154287
Hyperlipidemias	Associate	38277520
Hyperplasia	Associate	32006659
Hypertension	Associate	38277520
Hypoxia	Inhibit	10427991
Hypoxia	Stimulate	11556842
Hypoxia Brain	Associate	31424111
Inflammation	Associate	12909630, 15548526, 16179368, 16395252, 17898182, 26308008, 29845217, 29895319, 32787365, 32967511, 35408790, 37108638
Inflammation	Stimulate	25997515
Leukemia	Associate	17597825
Leukemia Hairy Cell	Associate	15001469
Leukemia Lymphocytic Chronic B Cell	Associate	15001469, 19383907
Leukemia Mast Cell	Associate	8188667
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	7780147
Leukemia Myeloid Acute	Associate	20154287, 27258612
Lichen Planus Oral	Associate	33107682
Liver Cirrhosis	Associate	20548789
Liver Diseases	Associate	20548789
Lung Neoplasms	Associate	19309748
Lung Neoplasms	Stimulate	30953795
Lupus Erythematosus Systemic	Associate	28954264
Lymphoma	Associate	20154287, 37798178
Lymphoma B Cell	Associate	20154287
Lymphoma B Cell Marginal Zone	Stimulate	22936065
Lymphoma Follicular	Associate	18174380, 35887224
Lymphoma Large B Cell Diffuse	Associate	20154287, 34516642
Lymphoma Large B Cell Diffuse	Stimulate	22936065, 35887224
Macular Degeneration	Associate	30894217
Majeed syndrome	Associate	33314777
Melanoma Cutaneous Malignant	Associate	31983065
Microscopic Polyangiitis	Associate	23690996, 28569178
Mucocutaneous Lymph Node Syndrome	Associate	33188570, 37001702
Multiple Myeloma	Associate	15730850, 17715391, 20154287
Multiple Sclerosis	Associate	11696431, 12909630, 15548526
Myocardial Infarction	Associate	38277520
Myocardial Ischemia	Associate	32967511, 38277520
Nasal Polyps	Associate	36466903
Neoplasm Metastasis	Associate	25048347, 26501423, 29285854
Neoplasms	Associate	17686053, 18215331, 20154287, 20429924, 31983065, 33277616, 33671956, 35710862, 37005667, 37224458, 37798178
Neurologic Manifestations	Associate	37108638
Obesity	Associate	19837927, 32188105
Osteoarthritis	Associate	31554310
Osteoarthritis Knee	Associate	32006659
Osteoporosis	Associate	36973348
Ovarian Neoplasms	Associate	11556842, 35750747
Parkinson Disease	Associate	23699752
Peri Implantitis	Associate	34858391
Periodontitis	Associate	38206700
Plaque Atherosclerotic	Associate	34308657
Prostatic Neoplasms	Associate	36806315
Pulmonary Arterial Hypertension	Stimulate	20808962
Pulmonary Arterial Hypertension	Associate	21425123
Pulmonary Disease Chronic Obstructive	Associate	33260035
Pulmonary Fibrosis	Stimulate	19729668
Respiratory Distress Syndrome	Associate	35222683
Schizophrenia	Associate	25487697
Sepsis	Associate	35222683
Skin Diseases	Associate	28954264
ST Elevation Myocardial Infarction	Associate	38597542
Status Asthmaticus	Stimulate	18178867
Stroke	Associate	38277520
Sutton disease 2	Associate	22727097
Thrombosis	Associate	38277520
Trigeminal Neuralgia	Stimulate	34067581

CCR1 (C-C motif chemokine receptor 1)