Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
122953
Gene name Gene Name - the full gene name approved by the HGNC.
Jun dimerization protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
JDP2
Synonyms (NCBI Gene) Gene synonyms aliases
JUNDM2
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q24.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT657104 hsa-miR-150-5p HITS-CLIP 23824327
MIRT657103 hsa-miR-6778-3p HITS-CLIP 23824327
MIRT657102 hsa-miR-4757-5p HITS-CLIP 23824327
MIRT657101 hsa-miR-6744-3p HITS-CLIP 23824327
MIRT657100 hsa-miR-6878-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II EXP 11231009
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 18671972
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608657 17546 ENSG00000140044
Protein
UniProt ID Q8WYK2
Protein name Jun dimerization protein 2
Protein function Component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Involved in a variety of transcriptional responses associated with AP-1 such as UV-induced apoptosis, cell differentiation, tumorig
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 70 133 bZIP transcription factor Coiled-coil
Sequence
MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKR
PQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEE
LKQERQQLILMLN
RHRPTCIVRTDSVKTPESEGNPLLEQLEKK
Sequence length 163
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Carcinoma Basal cell carcinoma N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholism Associate 34857913
Astrocytoma Associate 33108704
Carcinogenesis Associate 20677166
Carcinoma Basal Cell Associate 33212152
Colorectal Neoplasms Associate 35951156
Diabetic Nephropathies Associate 38374020
Endometriosis Associate 19389829
Immunoglobulin G4 Related Disease Associate 23230269
Insulin Resistance Associate 37883387
Leukemia Myeloid Acute Associate 20139074