Gene Gene information from NCBI Gene database.
Entrez ID 122953
Gene name Jun dimerization protein 2
Gene symbol JDP2
Synonyms (NCBI Gene)
JUNDM2
Chromosome 14
Chromosome location 14q24.3
miRNA miRNA information provided by mirtarbase database.
417
miRTarBase ID miRNA Experiments Reference
MIRT657104 hsa-miR-150-5p HITS-CLIP 23824327
MIRT657103 hsa-miR-6778-3p HITS-CLIP 23824327
MIRT657102 hsa-miR-4757-5p HITS-CLIP 23824327
MIRT657101 hsa-miR-6744-3p HITS-CLIP 23824327
MIRT657100 hsa-miR-6878-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II EXP 11231009
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 18671972
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608657 17546 ENSG00000140044
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WYK2
Protein name Jun dimerization protein 2
Protein function Component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Involved in a variety of transcriptional responses associated with AP-1 such as UV-induced apoptosis, cell differentiation, tumorig
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 70 133 bZIP transcription factor Coiled-coil
Sequence
MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKR
PQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEE
LKQERQQLILMLN
RHRPTCIVRTDSVKTPESEGNPLLEQLEKK
Sequence length 163
Interactions View interactions