Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	122618
Gene name Gene Name - the full gene name approved by the HGNC.	Phospholipase D family member 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PLD4
Synonyms (NCBI Gene) Gene synonyms aliases	C14orf175
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.33

Show/Hide all(41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016764	hsa-miR-335-5p	Microarray	18185580
MIRT1240306	hsa-miR-1343	CLIP-seq
MIRT1240307	hsa-miR-3179	CLIP-seq
MIRT1240308	hsa-miR-3202	CLIP-seq
MIRT1240309	hsa-miR-3690	CLIP-seq
MIRT1240310	hsa-miR-4254	CLIP-seq
MIRT1240311	hsa-miR-4292	CLIP-seq
MIRT1240312	hsa-miR-4308	CLIP-seq
MIRT1240313	hsa-miR-4721	CLIP-seq
MIRT1240314	hsa-miR-516a-3p	CLIP-seq
MIRT2070665	hsa-miR-1266	CLIP-seq
MIRT2070666	hsa-miR-24	CLIP-seq
MIRT2070667	hsa-miR-3151	CLIP-seq
MIRT1240310	hsa-miR-4254	CLIP-seq
MIRT2070668	hsa-miR-4283	CLIP-seq
MIRT1240311	hsa-miR-4292	CLIP-seq
MIRT1240312	hsa-miR-4308	CLIP-seq
MIRT2070669	hsa-miR-4437	CLIP-seq
MIRT2070670	hsa-miR-4489	CLIP-seq
MIRT2070671	hsa-miR-4518	CLIP-seq
MIRT1240306	hsa-miR-1343	CLIP-seq
MIRT2070667	hsa-miR-3151	CLIP-seq
MIRT2297822	hsa-miR-3689d	CLIP-seq
MIRT1240309	hsa-miR-3690	CLIP-seq
MIRT2297823	hsa-miR-378	CLIP-seq
MIRT2297824	hsa-miR-378b	CLIP-seq
MIRT2297825	hsa-miR-378c	CLIP-seq
MIRT2297826	hsa-miR-378d	CLIP-seq
MIRT2297827	hsa-miR-378e	CLIP-seq
MIRT2297828	hsa-miR-378f	CLIP-seq
MIRT2297829	hsa-miR-378h	CLIP-seq
MIRT2297830	hsa-miR-378i	CLIP-seq
MIRT2297831	hsa-miR-422a	CLIP-seq
MIRT1240310	hsa-miR-4254	CLIP-seq
MIRT2070668	hsa-miR-4283	CLIP-seq
MIRT1240311	hsa-miR-4292	CLIP-seq
MIRT1240312	hsa-miR-4308	CLIP-seq
MIRT2070670	hsa-miR-4489	CLIP-seq
MIRT1240313	hsa-miR-4721	CLIP-seq
MIRT1240314	hsa-miR-516a-3p	CLIP-seq
MIRT2297832	hsa-miR-765	CLIP-seq

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004527	Function	Exonuclease activity	IEA
GO:0004630	Function	Phospholipase D activity	ISS
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005764	Component	Lysosome	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005769	Component	Early endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0006259	Process	DNA metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006909	Process	Phagocytosis	IBA
GO:0006909	Process	Phagocytosis	IEA
GO:0006909	Process	Phagocytosis	ISS
GO:0006954	Process	Inflammatory response	IEA
GO:0012505	Component	Endomembrane system	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032588	Component	Trans-Golgi network membrane	IEA
GO:0032588	Component	Trans-Golgi network membrane	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0045145	Function	Single-stranded DNA 5'-3' DNA exonuclease activity	IEA
GO:0045145	Function	Single-stranded DNA 5'-3' DNA exonuclease activity	ISS
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0045335	Component	Phagocytic vesicle	ISS
GO:0051649	Process	Establishment of localization in cell	IEA
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	IEA
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	ISS

MIM	HGNC	e!Ensembl
618488	23792	ENSG00000166428

Protein

UniProt ID

Q96BZ4

Protein name

5'-3' exonuclease PLD4 (EC 3.1.16.1) ((S,S)-bis(monoacylglycero)phosphate synthase PLD4) (EC 3.1.4.-) (Phospholipase D family member 4) (Phospholipase D4)

Protein function

5'->3' exonuclease that hydrolyzes the phosphodiester bond of single-stranded DNA (ssDNA) and RNA molecules to form nucleoside 3'-monophosphates and 5'-end 5'-hydroxy deoxyribonucleotide/ribonucleotide fragments (PubMed:30111894, PubMed:34620855

PDB

8V08

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13918	PLDc_3	239 → 416	PLD-like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in plasmacytoid dendritic cells and monocytes (at protein level). {ECO:0000269|PubMed:38697119}.

Sequence

MLKPLWKAAVAPTWPCSMPPRRPWDREAGTLQVLGALAVLWLGSVALICLLWQVPRPPTW
GQVQPKDVPRSWEHGSSPAWEPLEAEARQQRDSCQLVLVESIPQDLPSAAGSPSAQPLGQ
AWLQLLDTAQESVHVASYYWSLTGPDIGVNDSSSQLGEALLQKLQQLLGRNISLAVATSS
PTLARTSTDLQVLAARGAHVRQVPMGRLTRGVLHSKFWVVDGRHIYMGSANMDWRSLTQV
KELGAVIYNCSHLAQDLEKTFQTYWVLGVPKAVLPKTWPQNFSSHFNRFQPFHGLFDGVP
TTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFPTTRFSHPPRYWPVLDN
ALRAAAFGKGVRVRLLVGCGLNTDPTMFPYLRSLQALSNPAANVSVDVKVFIVPVGNHSN
IPFSRVNHSKFMVTEKAAYIGTSNWSEDYFSSTAGVGLVVTQSPGAQPAGATVQEQLRQL
FERDWSSRYAVGLDGQAPGQDCVWQG

Sequence length

506

Interactions

View interactions

	KEGG		Reactome
	Glycerophospholipid metabolism Ether lipid metabolism Metabolic pathways		Synthesis of IP3 and IP4 in the cytosol Role of phospholipids in phagocytosis

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Glioblastoma	Glioblastoma	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	33288674
Arthritis Rheumatoid	Associate	23577190
Breast Neoplasms	Associate	34666190
Lupus Erythematosus Systemic	Associate	33288674, 37840148
Neuroinflammatory Diseases	Associate	35732154
Scleroderma Systemic	Associate	23124809
Spinocerebellar Ataxias	Associate	33288674

PLD4 (phospholipase D family member 4)