Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
122481
Gene name Gene Name - the full gene name approved by the HGNC.
Adenylate kinase 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AK7
Synonyms (NCBI Gene) Gene synonyms aliases
AK 7, CFAP75, FAP75, SPGF27
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q32.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the adenylate kinase family of enzymes. The encoded enzyme is a phosphotransferase that catalyzes the reversible phosphorylation of adenine nucleotides. This enzyme plays a role in energy homeostasis of the cell. Alternative
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs116298211 T>C,G Pathogenic, likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017406 hsa-miR-335-5p Microarray 18185580
MIRT756309 hsa-miR-370-5p qRT-PCR 38247802
MIRT775175 hsa-miR-1305 CLIP-seq
MIRT775176 hsa-miR-186 CLIP-seq
MIRT775177 hsa-miR-3133 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004017 Function AMP kinase activity IBA
GO:0004017 Function AMP kinase activity IDA 21080915
GO:0004017 Function AMP kinase activity IEA
GO:0004550 Function Nucleoside diphosphate kinase activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615364 20091 ENSG00000140057
Protein
UniProt ID Q96M32
Protein name Adenylate kinase 7 (AK 7) (EC 2.7.4.3) (EC 2.7.4.6) (ATP-AMP transphosphorylase 7)
Protein function Nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. Has highest activity toward AMP, and weaker activity toward dAMP, CMP and dCMP. Als
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00406 ADK 431 674 Domain
PF05186 Dpy-30 679 720 Dpy-30 motif Motif
Tissue specificity TISSUE SPECIFICITY: Expressed in sperm and airway epithelial cells (at protein level). {ECO:0000269|PubMed:29365104}.
Sequence
MAEEEETAALTEKVIRTQRVFINLLDSYSSGNIGKFLSNCVVGASLEEITEEEEEEDENK
SAMLEASSTKVKEGTFQIVGTLSKPDSPRPDFAVETYSAISREDLLMRLLECDVIIYNIT
ESSQQMEEAIWAVSALSEEVSHFEKRKLFILLSTVMTWARSKALDPEDSEVPFTEEDYRR
RKSHPNFLDHINAEKMVLKFGKKARKFAAYVVAAGLQYGAEGGMLHTFFKMAWLGEIPAL
PVFGDGTNVIPTIHVLDLAGVIQNVIDHVPKPHYLVAVDESVHTLEDIVKCISKNTGPGK
IQKIPRENAYLTKDLTQDCLDHLLVNLRMEALFVKENFNIRWAAQTGFVENINTILKEYK
QSRGLMPIKICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGE
GEEEVEEEEEEENVEDAQELLDGIKESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYIL
DGFPKTYDQAKDLFNQEDEEEEDDVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPE
SIVAGTHYSQDRFLRALSNYRDINIDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQ
LIKEIGEPRNYGLTDEEKAEEERKAAEERLAREAAEEAEREHQEAVEMAEKIARWEEWNK
RLEEVKREERELLE
AQSIPLRNYLMTYVMPTLIQGLNECCNVRPEDPVDFLAEYLFKNNP
EAQ
Sequence length 723
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Purine metabolism
Thiamine metabolism
Metabolic pathways
Nucleotide metabolism
Biosynthesis of cofactors
  Interconversion of nucleotide di- and triphosphates
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Spermatogenic Failure spermatogenic failure 27 rs116298211 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ciliary dyskinesia primary ciliary dyskinesia N/A N/A ClinVar, GenCC
Non-Syndromic Male Infertility Due To Sperm Motility Disorder non-syndromic male infertility due to sperm motility disorder N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Multiple Associate 34854019, 38492416
Asthenozoospermia Associate 38492416
Cardiomyopathy Dilated Associate 36401332
Chromosome Deletion Associate 32917334
Gastrointestinal Stromal Tumors Associate 32736695
Genetic Diseases Inborn Associate 32917334
Heart Failure Associate 36401332
Infertility Male Associate 38492416
Mitochondrial Diseases Associate 38492416
Oligospermia Associate 34854019, 38492416