SPACA7 (sperm acrosome associated 7)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
122258
Gene name Gene Name - the full gene name approved by the HGNC.
Sperm acrosome associated 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SPACA7
Synonyms (NCBI Gene) Gene synonyms aliases
C13orf28
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q34
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT2114198 hsa-miR-1539 CLIP-seq
MIRT2114199 hsa-miR-1976 CLIP-seq
MIRT2114200 hsa-miR-3155 CLIP-seq
MIRT2114201 hsa-miR-3155b CLIP-seq
MIRT2114202 hsa-miR-3183 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IDA 22495889
GO:0001669 Component Acrosomal vesicle IEA
GO:0005576 Component Extracellular region IEA
GO:0007338 Process Single fertilization IEA
GO:0031410 Component Cytoplasmic vesicle IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96KW9
Protein name Sperm acrosome-associated protein 7
Protein function Involved in fertilization. Seems not to play a direct role in sperm-egg binding or gamete fusion.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15307 SPACA7 19 → 126 Sperm acrosome-associated protein 7 Family
Tissue specificity TISSUE SPECIFICITY: Expressed in spermatozoa (at protein level) (PubMed:22495889). {ECO:0000269|PubMed:22495889}.
Sequence 
MAVSQGDGTLCFVLLLCCWQETELRPRTVIPGSPTEIPFSSKQEDMSELLDEILVQEILD
LNKTTPSEMPSTASTLSTPLHAGIDENYQAGGSENYHELLENLQFSPGIEVKISNDEANA
NANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQILQNIGRSSGNIFHK
EQQRTSAQRRSQGSQ
Sequence length 195
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma N/A N/A GWAS