Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	122011
Gene name Gene Name - the full gene name approved by the HGNC.	Casein kinase 1 alpha 1 like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CSNK1A1L
Synonyms (NCBI Gene) Gene synonyms aliases	CK1
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q13.3

Show/Hide all(36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020882	hsa-miR-155-5p	Proteomics	18668040
MIRT735157	hsa-miR-576-3p	Western blotting	32765697
MIRT912143	hsa-miR-1915	CLIP-seq
MIRT912144	hsa-miR-3163	CLIP-seq
MIRT912145	hsa-miR-323b-5p	CLIP-seq
MIRT912146	hsa-miR-4282	CLIP-seq
MIRT912147	hsa-miR-4434	CLIP-seq
MIRT912148	hsa-miR-450b-5p	CLIP-seq
MIRT912149	hsa-miR-4516	CLIP-seq
MIRT912150	hsa-miR-4531	CLIP-seq
MIRT912151	hsa-miR-4534	CLIP-seq
MIRT912152	hsa-miR-4699-3p	CLIP-seq
MIRT912153	hsa-miR-4708-3p	CLIP-seq
MIRT912154	hsa-miR-518a-5p	CLIP-seq
MIRT912155	hsa-miR-527	CLIP-seq
MIRT912156	hsa-miR-584	CLIP-seq
MIRT1970383	hsa-miR-3975	CLIP-seq
MIRT1970384	hsa-miR-4275	CLIP-seq
MIRT1970385	hsa-miR-4797-5p	CLIP-seq
MIRT1970386	hsa-miR-513b	CLIP-seq
MIRT2206320	hsa-miR-3122	CLIP-seq
MIRT912145	hsa-miR-323b-5p	CLIP-seq
MIRT2206321	hsa-miR-371-5p	CLIP-seq
MIRT2206322	hsa-miR-371b-5p	CLIP-seq
MIRT2206323	hsa-miR-3913-5p	CLIP-seq
MIRT1970383	hsa-miR-3975	CLIP-seq
MIRT1970384	hsa-miR-4275	CLIP-seq
MIRT2206324	hsa-miR-450b-3p	CLIP-seq
MIRT2206325	hsa-miR-4652-3p	CLIP-seq
MIRT2206326	hsa-miR-4777-3p	CLIP-seq
MIRT1970385	hsa-miR-4797-5p	CLIP-seq
MIRT1970386	hsa-miR-513b	CLIP-seq
MIRT912156	hsa-miR-584	CLIP-seq
MIRT2206327	hsa-miR-769-3p	CLIP-seq
MIRT2206328	hsa-miR-889	CLIP-seq
MIRT2206329	hsa-miR-935	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IBA	21873635
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA	21873635
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

Q8N752

Protein name

Casein kinase I isoform alpha-like (CKI-alpha-like) (EC 2.7.11.1) (CK1)

Protein function

Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	17 → 260	Protein kinase domain	Domain

Sequence

MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEDVAVKLESQKVKHPQLLYE
SKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKH
LIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLRAMTKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN

Sequence length

337

Interactions

View interactions

	KEGG
	Wnt signaling pathway Hedgehog signaling pathway Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Breast cancer Hepatocellular carcinoma Gastric cancer

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	14761950
Breast Neoplasms	Associate	37257767
Carcinogenesis	Associate	37257767
Coronary Artery Disease	Associate	34241534
Endometrial Neoplasms	Associate	37257767
Neoplasms	Associate	26738869
Plaque Amyloid	Associate	14761950

CSNK1A1L (casein kinase 1 alpha 1 like)