Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1211
Gene name Gene Name - the full gene name approved by the HGNC.	Clathrin light chain A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CLTA
Synonyms (NCBI Gene) Gene synonyms aliases	LCA
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytos

Show/Hide all(116)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020728	hsa-miR-155-5p	Proteomics	18668040
MIRT022724	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT029517	hsa-miR-26b-5p	Microarray	19088304
MIRT046362	hsa-miR-23b-3p	CLASH	23622248
MIRT107700	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT107700	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT107707	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT107701	hsa-miR-3159	PAR-CLIP	21572407
MIRT107702	hsa-miR-4255	PAR-CLIP	21572407
MIRT107712	hsa-miR-7852-3p	PAR-CLIP	21572407
MIRT558700	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT558699	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT558698	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT558697	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT558696	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT558695	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT558694	hsa-miR-6837-3p	PAR-CLIP	21572407
MIRT107709	hsa-miR-6073	PAR-CLIP	21572407
MIRT558693	hsa-miR-181b-2-3p	PAR-CLIP	21572407
MIRT558692	hsa-miR-181b-3p	PAR-CLIP	21572407
MIRT558691	hsa-miR-4420	PAR-CLIP	21572407
MIRT558690	hsa-miR-653-3p	PAR-CLIP	21572407
MIRT107710	hsa-miR-6869-5p	PAR-CLIP	21572407
MIRT107711	hsa-miR-1273h-3p	PAR-CLIP	21572407
MIRT107705	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT558689	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT107700	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT107700	hsa-miR-142-3p	PAR-CLIP	21572407
MIRT107707	hsa-miR-4662a-3p	PAR-CLIP	21572407
MIRT107701	hsa-miR-3159	PAR-CLIP	21572407
MIRT107702	hsa-miR-4255	PAR-CLIP	21572407
MIRT107712	hsa-miR-7852-3p	PAR-CLIP	21572407
MIRT558700	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT558699	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT558698	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT558697	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT558696	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT558695	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT558694	hsa-miR-6837-3p	PAR-CLIP	21572407
MIRT107709	hsa-miR-6073	PAR-CLIP	21572407
MIRT558693	hsa-miR-181b-2-3p	PAR-CLIP	21572407
MIRT558692	hsa-miR-181b-3p	PAR-CLIP	21572407
MIRT558691	hsa-miR-4420	PAR-CLIP	21572407
MIRT558690	hsa-miR-653-3p	PAR-CLIP	21572407
MIRT107710	hsa-miR-6869-5p	PAR-CLIP	21572407
MIRT107711	hsa-miR-1273h-3p	PAR-CLIP	21572407
MIRT107705	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT558689	hsa-miR-33a-3p	PAR-CLIP	21572407
MIRT898025	hsa-miR-1236	CLIP-seq
MIRT898026	hsa-miR-1304	CLIP-seq
MIRT898027	hsa-miR-1470	CLIP-seq
MIRT898028	hsa-miR-2467-5p	CLIP-seq
MIRT898029	hsa-miR-3127-3p	CLIP-seq
MIRT898030	hsa-miR-3183	CLIP-seq
MIRT898031	hsa-miR-3188	CLIP-seq
MIRT898032	hsa-miR-3667-3p	CLIP-seq
MIRT898033	hsa-miR-3975	CLIP-seq
MIRT898034	hsa-miR-4287	CLIP-seq
MIRT898035	hsa-miR-4330	CLIP-seq
MIRT898036	hsa-miR-4469	CLIP-seq
MIRT898037	hsa-miR-4667-3p	CLIP-seq
MIRT898038	hsa-miR-4685-3p	CLIP-seq
MIRT898039	hsa-miR-4691-5p	CLIP-seq
MIRT898040	hsa-miR-4723-3p	CLIP-seq
MIRT898041	hsa-miR-4747-5p	CLIP-seq
MIRT898042	hsa-miR-485-5p	CLIP-seq
MIRT898043	hsa-miR-635	CLIP-seq
MIRT898044	hsa-miR-642a	CLIP-seq
MIRT898045	hsa-miR-133a	CLIP-seq
MIRT898046	hsa-miR-133b	CLIP-seq
MIRT898035	hsa-miR-4330	CLIP-seq
MIRT898047	hsa-miR-4464	CLIP-seq
MIRT898048	hsa-miR-4509	CLIP-seq
MIRT898049	hsa-miR-4744	CLIP-seq
MIRT898050	hsa-miR-4748	CLIP-seq
MIRT898051	hsa-miR-548u	CLIP-seq
MIRT898052	hsa-miR-618	CLIP-seq
MIRT1556184	hsa-miR-1252	CLIP-seq
MIRT898026	hsa-miR-1304	CLIP-seq
MIRT898027	hsa-miR-1470	CLIP-seq
MIRT898028	hsa-miR-2467-5p	CLIP-seq
MIRT2202147	hsa-miR-25	CLIP-seq
MIRT898029	hsa-miR-3127-3p	CLIP-seq
MIRT898031	hsa-miR-3188	CLIP-seq
MIRT2202148	hsa-miR-32	CLIP-seq
MIRT2202149	hsa-miR-3611	CLIP-seq
MIRT2202150	hsa-miR-363	CLIP-seq
MIRT2202151	hsa-miR-367	CLIP-seq
MIRT898033	hsa-miR-3975	CLIP-seq
MIRT898035	hsa-miR-4330	CLIP-seq
MIRT898037	hsa-miR-4667-3p	CLIP-seq
MIRT2202152	hsa-miR-4709-3p	CLIP-seq
MIRT898041	hsa-miR-4747-5p	CLIP-seq
MIRT898042	hsa-miR-485-5p	CLIP-seq
MIRT898043	hsa-miR-635	CLIP-seq
MIRT898044	hsa-miR-642a	CLIP-seq
MIRT2202153	hsa-miR-92a	CLIP-seq
MIRT2202154	hsa-miR-92b	CLIP-seq
MIRT2202155	hsa-miR-943	CLIP-seq
MIRT1556184	hsa-miR-1252	CLIP-seq
MIRT1556184	hsa-miR-1252	CLIP-seq
MIRT2447226	hsa-miR-4270	CLIP-seq
MIRT2447227	hsa-miR-4427	CLIP-seq
MIRT2447228	hsa-miR-4441	CLIP-seq
MIRT2447229	hsa-miR-4680-3p	CLIP-seq
MIRT2447230	hsa-miR-4755-3p	CLIP-seq
MIRT1556184	hsa-miR-1252	CLIP-seq
MIRT898026	hsa-miR-1304	CLIP-seq
MIRT898028	hsa-miR-2467-5p	CLIP-seq
MIRT898031	hsa-miR-3188	CLIP-seq
MIRT898033	hsa-miR-3975	CLIP-seq
MIRT898035	hsa-miR-4330	CLIP-seq
MIRT898041	hsa-miR-4747-5p	CLIP-seq
MIRT898042	hsa-miR-485-5p	CLIP-seq
MIRT2678333	hsa-miR-494	CLIP-seq
MIRT898043	hsa-miR-635	CLIP-seq

Show/Hide all(36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	16595675, 21297582, 30021884
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0006886	Process	Intracellular protein transport	IEA
GO:0007049	Process	Cell cycle	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS
GO:0030118	Component	Clathrin coat	IMP	11756460
GO:0030118	Component	Clathrin coat	NAS	3267234
GO:0030125	Component	Clathrin vesicle coat	IBA	21873635
GO:0030130	Component	Clathrin coat of trans-Golgi network vesicle	IEA
GO:0030132	Component	Clathrin coat of coated pit	IEA
GO:0030672	Component	Synaptic vesicle membrane	IBA	21873635
GO:0031410	Component	Cytoplasmic vesicle	ISS
GO:0032050	Function	Clathrin heavy chain binding	IBA	21873635
GO:0032050	Function	Clathrin heavy chain binding	IPI	4066749
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032802	Process	Low-density lipoprotein particle receptor catabolic process	TAS
GO:0034383	Process	Low-density lipoprotein particle clearance	TAS
GO:0036020	Component	Endolysosome membrane	TAS
GO:0042277	Function	Peptide binding	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045334	Component	Clathrin-coated endocytic vesicle	NAS	25898166
GO:0048268	Process	Clathrin coat assembly	IBA	21873635
GO:0048268	Process	Clathrin coat assembly	IMP	11756460
GO:0051020	Function	GTPase binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0061024	Process	Membrane organization	TAS
GO:0071439	Component	Clathrin complex	IDA	4066749
GO:0072583	Process	Clathrin-dependent endocytosis	IBA	21873635
GO:0098835	Component	Presynaptic endocytic zone membrane	IEA
GO:0099631	Component	Postsynaptic endocytic zone cytoplasmic component	IBA	21873635

MIM	HGNC	e!Ensembl
118960	2090	ENSG00000122705

Protein

UniProt ID

P09496

Protein name

Clathrin light chain A (Lca)

Protein function

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as a component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-mi

PDB

6E5N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01086	Clathrin_lg_ch	15 → 247	Clathrin light chain	Family

Sequence

MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMER
LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV
TNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
LKQAPLVH

Sequence length

248

Interactions

View interactions

	KEGG		Reactome
	Lysosome Endocytosis Synaptic vesicle cycle Endocrine and other factor-regulated calcium reabsorption Huntington disease Bacterial invasion of epithelial cells		Entry of Influenza Virion into Host Cell via Endocytosis Retrograde neurotrophin signalling Gap junction degradation Formation of annular gap junctions MHC class II antigen presentation EPH-ephrin mediated repulsion of cells Lysosome Vesicle Biogenesis Golgi Associated Vesicle Biogenesis Recycling pathway of L1 WNT5A-dependent internalization of FZD4 WNT5A-dependent internalization of FZD2, FZD5 and ROR2 Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis VLDLR internalisation and degradation LDL clearance

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Myopathy	Myopathy	rs137854521, rs386834236, rs121908557, rs121909092, rs111033570, rs104894299, rs104894294, rs121909273, rs121909274, rs121909275, rs199474699, rs199476140, rs118192165, rs118192169, rs118192166 View all (81 more)
Sialuria	Sialuria	rs121908621, rs121908622, rs121908623, rs28937594, rs757523840	24695763, 26231298, 23278550, 15670773, 22196754, 12473753, 12497639, 21708040, 24796702, 22507750, 23437777, 16810679, 25182749, 20059379, 24005727 View all (15 more)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Inclusion body myopathy	NONAKA MYOPATHY		15987957, 23549799, 16810679, 20175955, 26231298, 23278550, 24005727, 16503651, 12473769, 15330759, 25617006, 26161358, 11528398, 12473753, 21708040 View all (49 more)	ClinVar

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining
Arthritis Rheumatoid	Associate	35273614
Carcinoma	Associate	40214395
Chondrosarcoma Extraskeletal Myxoid	Associate	24293381
Coronary Restenosis	Associate	35144391
Desmoplastic Small Round Cell Tumor	Associate	24293381
Diabetes Mellitus Type 2	Associate	32596376
Glioma	Associate	18474104
Hashimoto Disease	Associate	25380293
Laryngeal Neoplasms	Associate	40214395
Melanoma	Associate	31567589
Mesothelioma Malignant	Associate	19309551
Myoepithelioma	Associate	24293381
Osteoarthritis	Associate	34208719
Sarcoma	Associate	24293381, 34352867
Stomach Neoplasms	Associate	27895315

CLTA (clathrin light chain A)