POU2AF3 (POU class 2 homeobox associating factor 3)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 120376
Gene name POU class 2 homeobox associating factor 3
Gene symbol POU2AF3
Synonyms (NCBI Gene)
C11orf93CASC13COLCA2LOH11CR1GOCA-T2
Chromosome 11
Chromosome location 11q23.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
Gene Gene ontology Other IDs Protein
Show/Hide all (12)
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IDA 35576971
GO:0003677 Function DNA binding IEA
GO:0003713 Function Transcription coactivator activity IDA 35576971
GO:0005515 Function Protein binding IPI 35576971
GO:0005634 Component Nucleus IDA 35576971
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
615694 26978 ENSG00000214290
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8K830
Protein name POU class 2 homeobox associating factor 3 (Cancer susceptibility candidate protein 13) (Colorectal cancer-associated protein 2) (Protein OCA-T2)
Protein function Transcriptional coactivator that specifically associates with POU2F3 (PubMed:35576971). This complex drives the development of tuft cells, a rare a rare chemosensory cells that coordinate immune and neural functions within mucosal epithelial tis
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in many cell types of epithelial, mesenchymal and hematopoietic origins (PubMed:24154973). Expressed in tufs cells (PubMed:35576971). {ECO:0000269|PubMed:24154973, ECO:0000269|PubMed:35576971}.
Sequence 
MHPEPLLNSTQSAPHHFPDSFQATPFCFNQSLIPGSPSNSSILSGSLDYSYSPVQLPSYA
PENYNSPASLDTRTCGYPPEDHSYQHLSSHAQYSCFSSATTSICYCASCEAEDLDALQAA
EYFYPSTDCVDFAPSAAATSDFYKRETNCDICYS
Sequence length 154
Interactions View interactions