Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
120
Gene name Gene Name - the full gene name approved by the HGNC.
Adducin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ADD3
Synonyms (NCBI Gene) Gene synonyms aliases
ADDL, CPSQ3
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q25.1-q25.2
Summary Summary of gene provided in NCBI Entrez Gene.
Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs143966199 T>A Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs564185858 G>A Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016076 hsa-miR-374b-5p Sequencing 20371350
MIRT022859 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT030536 hsa-miR-24-3p Microarray 19748357
MIRT437436 hsa-miR-145-5p Flow, Luciferase reporter assay, qRT-PCR, Western blot 23814265
MIRT437436 hsa-miR-145-5p Flow, Luciferase reporter assay, qRT-PCR, Western blot 23814265
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000794 Component Condensed nuclear chromosome IEA
GO:0003779 Function Actin binding IEA
GO:0005080 Function Protein kinase C binding IEA
GO:0005200 Function Structural constituent of cytoskeleton IEA
GO:0005200 Function Structural constituent of cytoskeleton TAS 8893809
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601568 245 ENSG00000148700
Protein
UniProt ID Q9UEY8
Protein name Gamma-adducin (Adducin-like protein 70)
Protein function Membrane-cytoskeleton-associated protein that promotes the assembly of the spectrin-actin network. Plays a role in actin filament capping (PubMed:23836506). Binds to calmodulin (Probable). Involved in myogenic reactivity of the renal afferent ar
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00596 Aldolase_II 139 321 Class II Aldolase and Adducin N-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: [Isoform 1]: ubiquitously expressed. {ECO:0000269|PubMed:8893809}.; TISSUE SPECIFICITY: Cleavage fragment 1-357 is abundantly expressed in the brain of patients with Alzheimer disease (AD), but hardly detectable in age-matched control
Sequence
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQ
ILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPIN
DLPGADTSSYVKGEKLTRCKLASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLS
FSEATASNLVKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAAV
SSMKCGILPISQESLLLGDVAYYDYQGSLEEQEERIQLQKVLGPSCKVLVLRNHGVVALG
ETLEEAFHYIFNVQLACEIQV
QALAGAGGVDNLHVLDFQKYKAFTYTVAASGGGGVNMGS
HQKWKVGEIEFEGLMRTLDNLGYRTGYAYRHPLIREKPRHKSDVEIPATVTAFSFEDDTV
PLSPLKYMAQRQQREKTRWLNSPNTYMKVNVPEESRNGETSPRTKITWMKAEDSSKVSGG
TPIKIEDPNQFVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLAGIVVDKPPSTMQF
EDDDHGPPAPPNPFSHLTEGELEEYKRTIERKQQGLEDAEQELLSDDASSVSQIQSQTQS
PQNVPEKLEENHELFSKSFISMEVPVMVVNGKDDMHDVEDELAKRVSRLSTSTTIENIEI
TIKSPEKIEEVLSPEGSPSKSPSKKKKKFRTPSFLKKNKKKEKVEA
Sequence length 706
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Miscellaneous transport and binding events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Cerebral palsy cerebral palsy rs564185858 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Biliary Atresia Biliary atresia N/A N/A GWAS
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Breast cancer Breast cancer N/A N/A GWAS
Microcephaly microcephaly N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 30124448
Astrocytoma Associate 12937144
Biliary Atresia Associate 24104524, 25285724, 28902846, 29685956, 30358741, 32315284, 36114336, 37834180
Bipolar Disorder Associate 28072414
Carcinoma Non Small Cell Lung Associate 30290240
Frailty Associate 39464190
Glioblastoma Associate 12937144
Leukemia Myeloid Acute Associate 29286103
Liver Cirrhosis Associate 28902846
Lung Neoplasms Associate 33196842