Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	119395
Gene name Gene Name - the full gene name approved by the HGNC.	Calcium homeostasis modulator 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CALHM3
Synonyms (NCBI Gene) Gene synonyms aliases	FAM26A, bA225H22.7
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q24.33

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018398	hsa-miR-335-5p	Microarray	18185580

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005244	Function	Voltage-gated monoatomic ion channel activity	IEA
GO:0005244	Function	Voltage-gated monoatomic ion channel activity	ISS
GO:0005261	Function	Monoatomic cation channel activity	IBA
GO:0005262	Function	Calcium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	30126976
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0015867	Process	ATP transport	IEA
GO:0015867	Process	ATP transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0022832	Function	Voltage-gated channel activity	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0050909	Process	Sensory perception of taste	IEA
GO:0050909	Process	Sensory perception of taste	ISS
GO:0051291	Process	Protein heterooligomerization	IEA
GO:0051291	Process	Protein heterooligomerization	ISS
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:1904669	Process	ATP export	IEA

MIM	HGNC	e!Ensembl
618263	23458	ENSG00000183128

Protein

UniProt ID

Q86XJ0

Protein name

Calcium homeostasis modulator protein 3 (Protein A)

Protein function

Pore-forming subunit of gustatory voltage-gated ion channels required for sensory perception of sweet, bitter and umami tastes. With CALHM1 forms a fast-activating voltage-gated ATP-release channel in type II taste bud cells, ATP acting as a neu

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14798	Ca_hom_mod	1 → 252	Calcium homeostasis modulator	Family

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in circumvallate taste bud cells. {ECO:0000269|PubMed:19997627}.

Sequence

MDKFRMLFQHFQSSSESVMNGICLLLAAVTVKLYSSFDFNCPCLVHYNALYGLGLLLTPP
LALFLCGLLANRQSVVMVEEWRRPAGHRRKDPGIIRYMCSSVLQRALAAPLVWILLALLD
GKCFVCAFSSSVDPEKFLDFANMTPSQVQLFLAKVPCKEDELVRDSPARKAVSRYLRCLS
QAIGWSVTLLLIIAAFLARCLRPCFDQTVFLQRRYWSNYVDLEQKLFDETCCEHARDFAH
RCVLHFFASMRSELQARGLRRGNAGRRLELPAVPEPPEGLDSGSGKAHLRAISSREQVDR
LLSTWYSSKPPLDLAASPGLCGGGLSHRAPTLALGTRLSQHTDV

Sequence length

344

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Endometriosis	Endometriosis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (1)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Creutzfeldt Jakob Syndrome	Associate	22874670

CALHM3 (calcium homeostasis modulator 3)