Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1193
Gene name Gene Name - the full gene name approved by the HGNC.
Chloride intracellular channel 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLIC2
Synonyms (NCBI Gene) Gene synonyms aliases
CLCNL2, CLIC2b, MRXS32, XAP121
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MRXS32
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq28
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intrac
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs398122917 G>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017468 hsa-miR-335-5p Microarray 18185580
MIRT029268 hsa-miR-26b-5p Microarray 19088304
MIRT896243 hsa-miR-101 CLIP-seq
MIRT896244 hsa-miR-1254 CLIP-seq
MIRT896245 hsa-miR-1305 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004364 Function Glutathione transferase activity IDA 15147738
GO:0004602 Function Glutathione peroxidase activity IDA 15147738
GO:0005244 Function Voltage-gated ion channel activity IEA
GO:0005254 Function Chloride channel activity IBA 21873635
GO:0005515 Function Protein binding IPI 12681486, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300138 2063 ENSG00000155962
Protein
UniProt ID O15247
Protein name Chloride intracellular channel protein 2 (Glutaredoxin-like oxidoreductase CLIC2) (EC 1.8.-.-) (Glutaredoxin-like peroxidase CLIC2) (EC 1.11.1.-) (XAP121)
Protein function In the soluble state, catalyzes glutaredoxin-like thiol disulfide exchange reactions with reduced glutathione as electron donor. Displays weak glutathione peroxidase activity (Probable) (PubMed:25581026). Can insert into membranes and form chlor
PDB 2PER , 2R4V , 2R5G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13409 GST_N_2 29 93 Glutathione S-transferase, N-terminal domain Domain
PF13410 GST_C_2 74 218 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in adult and fetal brain, heart, skeletal muscle, liver, lung, and spleen. Detected in adult stomach and testis. Expressed in fetal thymus and kidney. {ECO:0000269|PubMed:15147738, ECO:0000269|PubMed:22814392}.
Sequence
MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEE
LKDLAPGTNPPFL
VYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKF
SAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLT
LADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHN
AYAREEFTHTCPEDKEIENTYA
NVAKQKS
Sequence length 247
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Stimuli-sensing channels
Ion homeostasis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Mitral valve prolapse Mitral Valve Prolapse Syndrome rs768737101
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure ClinVar
Intellectual disability-cardiomegaly-congestive heart failure syndrome, x-linked X-linked intellectual disability-cardiomegaly-congestive heart failure syndrome ClinVar
Neurodevelopmental Disorders X-linked complex neurodevelopmental disorder GenCC
Associations from Text Mining
Disease Name Relationship Type References
Atrial Fibrillation Associate 22814392
Carcinoma Hepatocellular Associate 34766585
Cardiomegaly Associate 22814392
Cardiomyopathy Dilated Associate 24339868
Channelopathies Associate 22814392
Colorectal Neoplasms Associate 30929599
Developmental Disabilities Associate 22814392
Genetic Diseases Inborn Associate 29257243
Heart Diseases Associate 22814392
Heart Failure Associate 22814392