Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
118813
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger FYVE-type containing 27
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZFYVE27
Synonyms (NCBI Gene) Gene synonyms aliases
PROTRUDIN, SPG33
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein with several transmembrane domains, a Rab11-binding domain and a lipid-binding FYVE finger domain. The encoded protein appears to promote neurite formation. A mutation in this gene has been reported to be associated with heredi
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1085307948 G>A Likely-pathogenic Intron variant, splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT042621 hsa-miR-423-3p CLASH 23622248
MIRT041333 hsa-miR-193b-3p CLASH 23622248
MIRT040082 hsa-miR-615-3p CLASH 23622248
MIRT454522 hsa-miR-5586-3p PAR-CLIP 23592263
MIRT454523 hsa-miR-4476 PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17082457, 18459960, 19289470, 21976701, 23969831, 24668814, 25855459, 32296183, 33961781, 35271311
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
GO:0005768 Component Endosome IEA
GO:0005783 Component Endoplasmic reticulum IDA 19289470
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610243 26559 ENSG00000155256
Protein
UniProt ID Q5T4F4
Protein name Protrudin (Spastic paraplegia 33 protein) (Zinc finger FYVE domain-containing protein 27)
Protein function Key regulator of RAB11-dependent vesicular trafficking during neurite extension through polarized membrane transport (PubMed:17082457). Promotes axonal elongation and contributes to the establishment of neuronal cell polarity (By similarity). In
PDB 1X4U
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01363 FYVE 339 411 FYVE zinc finger Domain
Sequence
MQTSEREGSGPELSPSVMPEAPLESPPFPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDG
VRYLLRWQMPLCSLLTCLGLNVLFLTLNEGAWYSVGALMISVPALLGYLQEVCRARLPDS
ELMRRKYHSVRQEDLQRGRLSRPEAVAEVKSFLIQLEAFLSRLCCTCEAAYRVLHWENPV
VSSQFYGALLGTVCMLYLLPLCWVLTLLNSTLFLGNVEFFRVVSEYRASLQQRMNPKQEE
HAFESPPPPDVGGKDGLMDSTPALTPTEDLTPGSVEEAEEAEPDEEFKDAIEETHLVVLE
DDEGAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNCTGCSATFSVL
KKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK
Sequence length 411
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Endocytosis  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hereditary spastic paraplegia Hereditary spastic paraplegia 33 N/A N/A ClinVar
Spastic Paraplegia spastic paraplegia, hereditary spastic paraplegia 33 N/A N/A ClinVar, GenCC
Spastic paraplegia Spastic paraplegia, autosomal dominant N/A N/A ClinVar
Spastic tetraparesis spastic tetraparesis N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 30283000
Neoplasms Associate 32479595
Paraplegia Associate 36573383
Sarcopenia Associate 36573383