ZNF488 (zinc finger protein 488)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 118738
Gene name Zinc finger protein 488
Gene symbol ZNF488
Synonyms (NCBI Gene)
-
Chromosome 10
Chromosome location 10q11.22
miRNA miRNA information provided by mirtarbase database.
323
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (323)
miRTarBase ID miRNA Experiments Reference
MIRT040838 hsa-miR-18a-3p CLASH 23622248
MIRT613505 hsa-miR-6892-3p HITS-CLIP 23824327
MIRT613504 hsa-miR-2276-5p HITS-CLIP 23824327
MIRT615269 hsa-miR-939-3p HITS-CLIP 23824327
MIRT613503 hsa-miR-6852-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (13)
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16713569, 25416956, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96MN9
Protein name Zinc finger protein 488
Protein function Transcriptional repressor. Plays a role in oligodendrocyte differentiation, together with OLIG2. Mediates Notch signaling-activated formation of oligodendrocyte precursors. Promotes differentiation of adult neural stem progenitor cells (NSPCs) i
Family and domains
Sequence 
MPEWPPCLSVAPALVITMAAGKGAPLSPSAENRWRLSEPELGRGCKPVLLEKTNRLGPEA
AVGRAGRDVGSAELALLVAPGKPRPGKPLPPKTRGEQRQSAFTELPRMKDRQVDAQAQER
EHDDPTGQPGAPQLTQNIPRGPAGSKVFSVWPSGARSEQRSAFSKPTKRPAERPELTSVF
PAGESADALGELSGLLNTTDLACWGRLSTPKLLVGDLWNLQALPQNAPLCSTFLGAPTLW
LEHTQAQVPPPSSSSTTSWALLPPTLTSLGLSTQNWCAKCNLSFRLTSDLVFHMRSHHKK
EHAGPDPHSQKRREEALACPVCQEHFRERHHLSRHMTSHS
Sequence length 340
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (4)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Carcinogenesis Associate 37986084
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 35865652
★★★★★
★☆☆☆☆
Found in Text Mining only
Pancreatic Neoplasms Associate 34394706, 35571561
★★★★★
★☆☆☆☆
Found in Text Mining only
Pancreatic Neoplasms Stimulate 35111235, 37986084
★★★★★
★☆☆☆☆
Found in Text Mining only