MUCL1 (mucin like 1)

Gene

• Entrez ID: 118430
• Gene name: Mucin like 1
• Gene symbol: MUCL1
• Synonyms (NCBI Gene): SBEM
• Chromosome: 12
• Chromosome location: 12q13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1166420	hsa-miR-488	CLIP-seq
MIRT2276861	hsa-miR-1244	CLIP-seq
MIRT2276862	hsa-miR-1255a	CLIP-seq
MIRT2276863	hsa-miR-1255b	CLIP-seq
MIRT2276864	hsa-miR-1303	CLIP-seq
MIRT2276865	hsa-miR-298	CLIP-seq
MIRT2276866	hsa-miR-3678-3p	CLIP-seq
MIRT2276867	hsa-miR-3920	CLIP-seq
MIRT2276868	hsa-miR-4259	CLIP-seq
MIRT2276869	hsa-miR-4432	CLIP-seq
MIRT2276870	hsa-miR-4703-3p	CLIP-seq
MIRT2276871	hsa-miR-4715-5p	CLIP-seq
MIRT2276872	hsa-miR-487b	CLIP-seq
MIRT2276873	hsa-miR-513a-5p	CLIP-seq
MIRT2276874	hsa-miR-548ag	CLIP-seq
MIRT2276875	hsa-miR-548ai	CLIP-seq
MIRT2276876	hsa-miR-548g	CLIP-seq
MIRT2276877	hsa-miR-562	CLIP-seq
MIRT2276878	hsa-miR-577	CLIP-seq
MIRT2276879	hsa-miR-758	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 610857
• HGNC: 30588
• e!Ensembl: ENSG00000172551

Protein

• UniProt ID: Q96DR8
• Protein name: Mucin-like protein 1 (Protein BS106) (Small breast epithelial mucin)
• Protein function: May play a role as marker for the diagnosis of metastatic breast cancer.
• Tissue specificity: TISSUE SPECIFICITY: Expressed in mammary, salivary glands and prostate. Also detected in lung. Mainly expressed in cancer cell lines of breast origin. Highly expressed in lymph node-positive compared with node-negative tumors. Detected in all lymph node c
• Sequence:

  MKFLAVLVLLGVSIFLVSAQNPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTT
  ATTAASTTARKDIPVLPKWVGDLPNGRVCP

• Sequence length: 90

Pathways

Reactome:

Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
Defective GALNT12 causes colorectal cancer 1 (CRCS1)
Dectin-2 family
O-linked glycosylation of mucins
Termination of O-glycan biosynthesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BLOOD COAGULATION DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Associate	15096563, 18253069, 18269587, 19221791, 26725324, 32627029, 35059735, 37477531	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	31568004	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	35059735	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	26725324	★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	34545566	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Associate	34545566	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	34545566	★☆☆☆☆ Found in Text Mining only
Neoplasm Micrometastasis	Associate	19221791	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	19221791, 26725324	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	37579183	★☆☆☆☆ Found in Text Mining only