Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	118424
Gene name	Ubiquitin conjugating enzyme E2 J2
Gene symbol	UBE2J2
Synonyms (NCBI Gene)	NCUBE-2NCUBE2PRO2121UBC6
Chromosome	1
Chromosome location	1p36.33
Summary	The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conju

Show/Hide all (48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020523	hsa-miR-155-5p	Proteomics	18668040
MIRT042648	hsa-miR-423-3p	CLASH	23622248
MIRT036006	hsa-miR-1301-3p	CLASH	23622248
MIRT1468025	hsa-miR-1283	CLIP-seq
MIRT1468026	hsa-miR-3186-3p	CLIP-seq
MIRT1468027	hsa-miR-338-3p	CLIP-seq
MIRT1468028	hsa-miR-3922-5p	CLIP-seq
MIRT1468029	hsa-miR-4457	CLIP-seq
MIRT1468030	hsa-miR-4530	CLIP-seq
MIRT1468031	hsa-miR-4731-3p	CLIP-seq
MIRT1468032	hsa-miR-4801	CLIP-seq
MIRT1468033	hsa-miR-939	CLIP-seq
MIRT1468034	hsa-miR-1204	CLIP-seq
MIRT1468035	hsa-miR-1226	CLIP-seq
MIRT1468036	hsa-miR-1294	CLIP-seq
MIRT1468037	hsa-miR-1321	CLIP-seq
MIRT1468038	hsa-miR-2467-5p	CLIP-seq
MIRT1468039	hsa-miR-3126-5p	CLIP-seq
MIRT1468040	hsa-miR-3188	CLIP-seq
MIRT1468028	hsa-miR-3922-5p	CLIP-seq
MIRT1468041	hsa-miR-3925-3p	CLIP-seq
MIRT1468042	hsa-miR-3975	CLIP-seq
MIRT1468043	hsa-miR-4316	CLIP-seq
MIRT1468044	hsa-miR-4323	CLIP-seq
MIRT1468045	hsa-miR-4419a	CLIP-seq
MIRT1468046	hsa-miR-4435	CLIP-seq
MIRT1468047	hsa-miR-4436a	CLIP-seq
MIRT1468048	hsa-miR-4446-3p	CLIP-seq
MIRT1468049	hsa-miR-4510	CLIP-seq
MIRT1468050	hsa-miR-4649-3p	CLIP-seq
MIRT1468051	hsa-miR-4656	CLIP-seq
MIRT1468052	hsa-miR-4739	CLIP-seq
MIRT1468053	hsa-miR-4756-5p	CLIP-seq
MIRT1468054	hsa-miR-4764-5p	CLIP-seq
MIRT1468055	hsa-miR-485-5p	CLIP-seq
MIRT2140657	hsa-miR-4267	CLIP-seq
MIRT2361620	hsa-miR-2115	CLIP-seq
MIRT2361621	hsa-miR-3127-3p	CLIP-seq
MIRT1468026	hsa-miR-3186-3p	CLIP-seq
MIRT2361622	hsa-miR-4263	CLIP-seq
MIRT2361623	hsa-miR-516a-3p	CLIP-seq
MIRT2361624	hsa-miR-576-5p	CLIP-seq
MIRT1468033	hsa-miR-939	CLIP-seq
MIRT2462796	hsa-miR-4329	CLIP-seq
MIRT2462797	hsa-miR-4663	CLIP-seq
MIRT2462798	hsa-miR-4728-3p	CLIP-seq
MIRT2462799	hsa-miR-4786-5p	CLIP-seq
MIRT2462800	hsa-miR-769-5p	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IPI	24807418
GO:0000166	Function	Nucleotide binding	IEA
GO:0000209	Process	Protein polyubiquitination	IBA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IMP	24807418
GO:0006986	Process	Response to unfolded protein	IEA
GO:0016020	Component	Membrane	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	24019521
GO:0036503	Process	ERAD pathway	IBA
GO:0036503	Process	ERAD pathway	IMP	24807418
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IBA
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IDA	20061386, 36528027
GO:0061631	Function	Ubiquitin conjugating enzyme activity	IEA
GO:0085020	Process	Protein K6-linked ubiquitination	IDA	36528027
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24270810

MIM	HGNC	e!Ensembl
619756	19268	ENSG00000160087

Q8N2K1

Protein name

Ubiquitin-conjugating enzyme E2 J2 (EC 2.3.2.23) (E2 ubiquitin-conjugating enzyme J2) (Non-canonical ubiquitin-conjugating enzyme 2) (NCUBE-2)

Protein function

Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD) (By similarity). In cooperation with the GATOR2 complex, cataly

PDB

2F4W

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00179	UQ_con	16 → 136	Ubiquitin-conjugating enzyme	Domain

Sequence

MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGY
YHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLS
FMVEKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSR
PQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIV
GFAAFAYTVKYVLRSIAQE

Sequence length

259

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis Protein processing in endoplasmic reticulum Parkinson disease Pathways of neurodegeneration - multiple diseases		E3 ubiquitin ligases ubiquitinate target proteins Insertion of tail-anchored proteins into the endoplasmic reticulum membrane Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

UBE2J2 (ubiquitin conjugating enzyme E2 J2)