Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1180
Gene name Gene Name - the full gene name approved by the HGNC.
Chloride voltage-gated channel 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLCN1
Synonyms (NCBI Gene) Gene synonyms aliases
CLC1
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q34
Summary Summary of gene provided in NCBI Entrez Gene.
The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. The protein encoded by this gene regulates the
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs55960271 C>A,T Pathogenic, likely-pathogenic Non coding transcript variant, stop gained, synonymous variant, coding sequence variant
rs80356684 A>T Pathogenic Non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs80356685 C>G Uncertain-significance, pathogenic, likely-pathogenic Non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs80356686 G>A Pathogenic Non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant
rs80356687 C>T Pathogenic-likely-pathogenic, pathogenic Missense variant, intron variant, non coding transcript variant, genic upstream transcript variant, coding sequence variant
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005247 Function Voltage-gated chloride channel activity IBA 21873635
GO:0005247 Function Voltage-gated chloride channel activity IMP 22521272, 26007199, 26502825
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
118425 2019 ENSG00000188037
Protein
UniProt ID P35523
Protein name Chloride channel protein 1 (ClC-1) (Chloride channel protein, skeletal muscle)
Protein function Voltage-gated chloride channel involved in skeletal muscle excitability. Generates most of the plasma membrane chloride conductance in skeletal muscle fibers, stabilizes the resting membrane potential and contributes to the repolarization phase
PDB 6COY , 6COZ , 6QV6 , 6QVB , 6QVC , 6QVD , 6QVU , 8WXI , 8WXJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00654 Voltage_CLC 170 572 Voltage gated chloride channel Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in skeletal muscles.
Sequence
MEQSRSQQRGGEQSWWGSDPQYQYMPFEHCTSYGLPSENGGLQHRLRKDAGPRHNVHPTQ
IYGHHKEQFSDREQDIGMPKKTGSSSTVDSKDEDHYSKCQDCIHRLGQVVRRKLGEDGIF
LVLLGLLMALVSWSMDYVSAKSLQAYKWSYAQMQPSLPLQFLVWVTFPLVLILFSALFCH
LISPQAVGSGIPEMKTILRGVVLKEYLTMKAFVAKVVALTAGLGSGIPVGKEGPFVHIAS
ICAAVLSKFMSVFCGVYEQPYYYSDILTVGCAVGVGCCFGTPLGGVLFSIEVTSTYFAVR
NYWRGFFAATFSAFVFRVLAVWNKDAVTITALFRTNFRMDFPFDLKELPAFAAIGICCGL
LGAVFVYLHRQVMLGVRKHKALSQFLAKHRLLYPGIVTFVIASFTFPPGMGQFMAGELMP
REAISTLFDNNTWVKHAGDPESLGQSAVWIHPRVNVVIIIFLFFVMKFWMSIVATTMPIP
CGGFMPVFVLGAAFGRLVGEIMAMLFPDGILFDDIIYKILPGGYAVIGAAALTGAVSHTV
STAVICFELTGQIAHILPMMVAVILANMVAQS
LQPSLYDSIIQVKKLPYLPDLGWNQLSK
YTIFVEDIMVRDVKFVSASYTYGELRTLLQTTTVKTLPLVDSKDSMILLGSVERSELQAL
LQRHLCPERRLRAAQEMARKLSELPYDGKARLAGEGLPGAPPGRPESFAFVDEDEDEDLS
GKSELPPSLALHPSTTAPLSPEEPNGPLPGHKQQPEAPEPAGQRPSIFQSLLHCLLGRAR
PTKKKTTQDSTDLVDNMSPEEIEAWEQEQLSQPVCFDSCCIDQSPFQLVEQTTLHKTHTL
FSLLGLHLAYVTSMGKLRGVLALEELQKAIEGHTKSGVQLRPPLASFRNTTSTRKSTGAP
PSSAENWNLPEDRPGATGTGDVIAASPETPVPSPSPEPPLSLAPGKVEGELEELELVESP
GLEEELADILQGPSLRSTDEEDEDELIL
Sequence length 988
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Stimuli-sensing channels
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Congenital myotonia Becker Generalized Myotonia, Generalized Myotonia of Thomsen rs121912799, rs80356700, rs1563078827, rs121912801, rs80356694, rs80356696, rs80356690, rs121912805, rs80356702, rs121912807, rs140026363, rs55960271, rs80356699, rs1586496726, rs80356703
View all (43 more)
27614575, 23152584, 12390967, 19697366, 22521272, 1379744, 9566422, 10665666, 27118449, 18035046, 11840191, 27415035, 21221019, 26510092, 7951215
View all (80 more)
Hyperkalemic periodic paralysis Hyperkalemic periodic paralysis rs80338957, rs80338962, rs121908544, rs121908545, rs80338958, rs121908546, rs121908556, rs80338792, rs121908547, rs121908548, rs121908549, rs121908551, rs121908552, rs80338784, rs80338788
View all (36 more)
22649220
Myopathy Myopathy rs137854521, rs386834236, rs121908557, rs121909092, rs111033570, rs104894299, rs104894294, rs121909273, rs121909274, rs121909275, rs199474699, rs199476140, rs118192165, rs118192169, rs118192166
View all (81 more)
Unknown
Disease term Disease name Evidence References Source
Myocardial infarction Myocardial Infarction ClinVar
Myotonia Congenita myotonia congenita, autosomal dominant, myotonia congenita, autosomal recessive GenCC
Associations from Text Mining
Disease Name Relationship Type References
Andersen Syndrome Associate 23516313
Arrhythmias Cardiac Associate 33263785
Channelopathies Associate 26502825, 27199537
Cognition Disorders Associate 29851785
Conduct Disorder Associate 33263785
Depressive Disorder Associate 23933576
Dystonia 18 Associate 27098784
Epilepsy Associate 25036107, 38544349
Familial paroxysmal dystonia Associate 25205014, 27098784
Fasciculation Associate 27580824