Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
117854
Gene name Gene Name - the full gene name approved by the HGNC.
Tripartite motif containing 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRIM6
Synonyms (NCBI Gene) Gene synonyms aliases
RNF89
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.4
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, B-box type 1 and B-box type 2 domain, and a coiled-coil region. The protein localizes to the nucleus, but its s
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029893 hsa-miR-26b-5p Microarray 19088304
MIRT1455584 hsa-miR-129-5p CLIP-seq
MIRT1455585 hsa-miR-3165 CLIP-seq
MIRT1455586 hsa-miR-331-5p CLIP-seq
MIRT1455587 hsa-miR-3614-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IEA
GO:0002230 Process Positive regulation of defense response to virus by host IMP 24882218
GO:0002720 Process Positive regulation of cytokine production involved in immune response IMP 24882218
GO:0005515 Function Protein binding IPI 25127057
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607564 16277 ENSG00000121236
Protein
UniProt ID Q9C030
Protein name Tripartite motif-containing protein 6 (EC 2.3.2.27) (RING finger protein 89) (RING-type E3 ubiquitin transferase TRIM6)
Protein function E3 ubiquitin ligase that plays a crucial role in the activation of the IKBKE-dependent branch of the type I interferon signaling pathway (PubMed:24882218, PubMed:31694946). In concert with the ubiquitin-conjugating E2 enzyme UBE2K, synthesizes u
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13445 zf-RING_UBOX 15 57 RING-type zinc-finger Domain
PF00643 zf-B_box 93 133 B-box zinc finger Domain
PF00622 SPRY 354 483 SPRY domain Family
Sequence
MTSPVLVDIREEVTCPICLELLTEPLSIDCGHSFCQACITPNGRESVIGQEGERSCPVCQ
TSYQPGNLRPNRHLANIVRRLREVVLGPGKQLKAVLCADHGEKLQLFCQEDGKVICWLCE
RSQEHRGHHTFLV
EEVAQEYQEKFQESLKKLKNEEQEAEKLTAFIREKKTSWKNQMEPER
CRIQTEFNQLRNILDRVEQRELKKLEQEEKKGLRIIEEAENDLVHQTQSLRELISDLERR
CQGSTMELLQDVSDVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVCRELTDVQSYW
VDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFSSGKHYWEVD
VAKKTAWILGVCSNSLGPTFSFNHFAQNHSAYSRYQPQSGYWVIGLQHNHEYRAYEDSSP
SLLLSMTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPCNCVIP
MTL
RRPSS
Sequence length 488
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interferon gamma signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atherosclerosis Associate 37370144
Cerebral Infarction Associate 37370144
Fibrosis Associate 38420829
Glioma Associate 37759698
Inflammation Associate 37759698
Virus Diseases Associate 40296166
West Nile Fever Associate 31694946