Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	117854
Gene name Gene Name - the full gene name approved by the HGNC.	Tripartite motif containing 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRIM6
Synonyms (NCBI Gene) Gene synonyms aliases	RNF89
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.4
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, B-box type 1 and B-box type 2 domain, and a coiled-coil region. The protein localizes to the nucleus, but its s

Show/Hide all(186)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029893	hsa-miR-26b-5p	Microarray	19088304
MIRT1455584	hsa-miR-129-5p	CLIP-seq
MIRT1455585	hsa-miR-3165	CLIP-seq
MIRT1455586	hsa-miR-331-5p	CLIP-seq
MIRT1455587	hsa-miR-3614-5p	CLIP-seq
MIRT1455588	hsa-miR-3616-5p	CLIP-seq
MIRT1455589	hsa-miR-3647-5p	CLIP-seq
MIRT1455590	hsa-miR-3656	CLIP-seq
MIRT1455591	hsa-miR-4433	CLIP-seq
MIRT1455592	hsa-miR-4678	CLIP-seq
MIRT1455593	hsa-miR-4768-3p	CLIP-seq
MIRT1455594	hsa-miR-573	CLIP-seq
MIRT1455595	hsa-miR-1273	CLIP-seq
MIRT1455596	hsa-miR-3613-3p	CLIP-seq
MIRT1455597	hsa-miR-371-5p	CLIP-seq
MIRT1455598	hsa-miR-371b-5p	CLIP-seq
MIRT1455599	hsa-miR-383	CLIP-seq
MIRT1455600	hsa-miR-3617	CLIP-seq
MIRT1455601	hsa-miR-641	CLIP-seq
MIRT2357383	hsa-miR-1206	CLIP-seq
MIRT2357384	hsa-miR-1236	CLIP-seq
MIRT2357385	hsa-miR-1279	CLIP-seq
MIRT2357386	hsa-miR-146a	CLIP-seq
MIRT2357387	hsa-miR-146b-5p	CLIP-seq
MIRT2357388	hsa-miR-300	CLIP-seq
MIRT2357389	hsa-miR-302a	CLIP-seq
MIRT2357390	hsa-miR-302b	CLIP-seq
MIRT2357391	hsa-miR-302c	CLIP-seq
MIRT2357392	hsa-miR-302d	CLIP-seq
MIRT2357393	hsa-miR-302e	CLIP-seq
MIRT2357394	hsa-miR-3154	CLIP-seq
MIRT2357395	hsa-miR-372	CLIP-seq
MIRT2357396	hsa-miR-373	CLIP-seq
MIRT2357397	hsa-miR-381	CLIP-seq
MIRT1455599	hsa-miR-383	CLIP-seq
MIRT2357398	hsa-miR-3926	CLIP-seq
MIRT1455591	hsa-miR-4433	CLIP-seq
MIRT2357399	hsa-miR-4666-3p	CLIP-seq
MIRT2357400	hsa-miR-4753-3p	CLIP-seq
MIRT1455593	hsa-miR-4768-3p	CLIP-seq
MIRT2357401	hsa-miR-4768-5p	CLIP-seq
MIRT2357402	hsa-miR-4789-5p	CLIP-seq
MIRT2357403	hsa-miR-519a	CLIP-seq
MIRT2357404	hsa-miR-519b-3p	CLIP-seq
MIRT2357405	hsa-miR-519c-3p	CLIP-seq
MIRT2357406	hsa-miR-520a-3p	CLIP-seq
MIRT2357407	hsa-miR-520b	CLIP-seq
MIRT2357408	hsa-miR-520c-3p	CLIP-seq
MIRT2357409	hsa-miR-520d-3p	CLIP-seq
MIRT2357410	hsa-miR-520e	CLIP-seq
MIRT2357411	hsa-miR-548ae	CLIP-seq
MIRT2357412	hsa-miR-548aj	CLIP-seq
MIRT2357413	hsa-miR-548am	CLIP-seq
MIRT2357414	hsa-miR-548s	CLIP-seq
MIRT2357415	hsa-miR-548x	CLIP-seq
MIRT2357416	hsa-miR-589	CLIP-seq
MIRT2357417	hsa-miR-599	CLIP-seq
MIRT2651094	hsa-miR-1229	CLIP-seq
MIRT2651095	hsa-miR-1231	CLIP-seq
MIRT1455595	hsa-miR-1273	CLIP-seq
MIRT2651096	hsa-miR-1278	CLIP-seq
MIRT2651097	hsa-miR-1285	CLIP-seq
MIRT2651098	hsa-miR-137	CLIP-seq
MIRT2651099	hsa-miR-148a	CLIP-seq
MIRT2651100	hsa-miR-148b	CLIP-seq
MIRT2651101	hsa-miR-152	CLIP-seq
MIRT2651102	hsa-miR-1825	CLIP-seq
MIRT2651103	hsa-miR-197	CLIP-seq
MIRT2651104	hsa-miR-1972	CLIP-seq
MIRT2651105	hsa-miR-25	CLIP-seq
MIRT2357388	hsa-miR-300	CLIP-seq
MIRT2651106	hsa-miR-3120-5p	CLIP-seq
MIRT2651107	hsa-miR-3122	CLIP-seq
MIRT2651108	hsa-miR-3128	CLIP-seq
MIRT2651109	hsa-miR-3133	CLIP-seq
MIRT1455585	hsa-miR-3165	CLIP-seq
MIRT2651110	hsa-miR-3178	CLIP-seq
MIRT2651111	hsa-miR-3187-5p	CLIP-seq
MIRT2651112	hsa-miR-32	CLIP-seq
MIRT2651113	hsa-miR-324-5p	CLIP-seq
MIRT2651114	hsa-miR-33a	CLIP-seq
MIRT2651115	hsa-miR-33b	CLIP-seq
MIRT2651116	hsa-miR-3607-3p	CLIP-seq
MIRT1455596	hsa-miR-3613-3p	CLIP-seq
MIRT2651117	hsa-miR-363	CLIP-seq
MIRT1455590	hsa-miR-3656	CLIP-seq
MIRT2651118	hsa-miR-367	CLIP-seq
MIRT2651119	hsa-miR-3686	CLIP-seq
MIRT2651120	hsa-miR-3689a-3p	CLIP-seq
MIRT2651121	hsa-miR-3689c	CLIP-seq
MIRT1455597	hsa-miR-371-5p	CLIP-seq
MIRT1455598	hsa-miR-371b-5p	CLIP-seq
MIRT2651122	hsa-miR-378g	CLIP-seq
MIRT2357397	hsa-miR-381	CLIP-seq
MIRT2651123	hsa-miR-3913-5p	CLIP-seq
MIRT2651124	hsa-miR-3960	CLIP-seq
MIRT2651125	hsa-miR-3973	CLIP-seq
MIRT2651126	hsa-miR-4284	CLIP-seq
MIRT2651127	hsa-miR-4438	CLIP-seq
MIRT2651128	hsa-miR-4470	CLIP-seq
MIRT2651129	hsa-miR-4479	CLIP-seq
MIRT2651130	hsa-miR-4486	CLIP-seq
MIRT2651131	hsa-miR-4495	CLIP-seq
MIRT2651132	hsa-miR-4511	CLIP-seq
MIRT2651133	hsa-miR-452	CLIP-seq
MIRT2651134	hsa-miR-4649-5p	CLIP-seq
MIRT2357399	hsa-miR-4666-3p	CLIP-seq
MIRT2651135	hsa-miR-4676-3p	CLIP-seq
MIRT2357402	hsa-miR-4789-5p	CLIP-seq
MIRT2651136	hsa-miR-4795-3p	CLIP-seq
MIRT2651137	hsa-miR-490-3p	CLIP-seq
MIRT2651138	hsa-miR-508-5p	CLIP-seq
MIRT2651139	hsa-miR-5095	CLIP-seq
MIRT2651140	hsa-miR-548a-5p	CLIP-seq
MIRT2651141	hsa-miR-548ab	CLIP-seq
MIRT2651142	hsa-miR-548ad	CLIP-seq
MIRT2651143	hsa-miR-548ak	CLIP-seq
MIRT2651144	hsa-miR-548b-5p	CLIP-seq
MIRT2651145	hsa-miR-548c-3p	CLIP-seq
MIRT2651146	hsa-miR-548c-5p	CLIP-seq
MIRT2651147	hsa-miR-548d-5p	CLIP-seq
MIRT2651148	hsa-miR-548h	CLIP-seq
MIRT2651149	hsa-miR-548i	CLIP-seq
MIRT2651150	hsa-miR-548j	CLIP-seq
MIRT2651151	hsa-miR-548w	CLIP-seq
MIRT2651152	hsa-miR-548y	CLIP-seq
MIRT2651153	hsa-miR-559	CLIP-seq
MIRT2651154	hsa-miR-612	CLIP-seq
MIRT2651155	hsa-miR-661	CLIP-seq
MIRT2651156	hsa-miR-766	CLIP-seq
MIRT2651157	hsa-miR-92a	CLIP-seq
MIRT2651158	hsa-miR-92b	CLIP-seq
MIRT2651094	hsa-miR-1229	CLIP-seq
MIRT2651096	hsa-miR-1278	CLIP-seq
MIRT2651098	hsa-miR-137	CLIP-seq
MIRT2651103	hsa-miR-197	CLIP-seq
MIRT2651104	hsa-miR-1972	CLIP-seq
MIRT2651105	hsa-miR-25	CLIP-seq
MIRT2357388	hsa-miR-300	CLIP-seq
MIRT2651107	hsa-miR-3122	CLIP-seq
MIRT2651108	hsa-miR-3128	CLIP-seq
MIRT2651112	hsa-miR-32	CLIP-seq
MIRT2651113	hsa-miR-324-5p	CLIP-seq
MIRT2651114	hsa-miR-33a	CLIP-seq
MIRT2651115	hsa-miR-33b	CLIP-seq
MIRT2651116	hsa-miR-3607-3p	CLIP-seq
MIRT1455596	hsa-miR-3613-3p	CLIP-seq
MIRT2651117	hsa-miR-363	CLIP-seq
MIRT1455590	hsa-miR-3656	CLIP-seq
MIRT2651118	hsa-miR-367	CLIP-seq
MIRT2651119	hsa-miR-3686	CLIP-seq
MIRT2651120	hsa-miR-3689a-3p	CLIP-seq
MIRT2651121	hsa-miR-3689c	CLIP-seq
MIRT1455597	hsa-miR-371-5p	CLIP-seq
MIRT1455598	hsa-miR-371b-5p	CLIP-seq
MIRT2357397	hsa-miR-381	CLIP-seq
MIRT2651123	hsa-miR-3913-5p	CLIP-seq
MIRT2651125	hsa-miR-3973	CLIP-seq
MIRT2651127	hsa-miR-4438	CLIP-seq
MIRT2651128	hsa-miR-4470	CLIP-seq
MIRT2651131	hsa-miR-4495	CLIP-seq
MIRT2651133	hsa-miR-452	CLIP-seq
MIRT2357399	hsa-miR-4666-3p	CLIP-seq
MIRT2651135	hsa-miR-4676-3p	CLIP-seq
MIRT2357402	hsa-miR-4789-5p	CLIP-seq
MIRT2651136	hsa-miR-4795-3p	CLIP-seq
MIRT2651137	hsa-miR-490-3p	CLIP-seq
MIRT2651139	hsa-miR-5095	CLIP-seq
MIRT2694188	hsa-miR-541	CLIP-seq
MIRT2651140	hsa-miR-548a-5p	CLIP-seq
MIRT2651141	hsa-miR-548ab	CLIP-seq
MIRT2651142	hsa-miR-548ad	CLIP-seq
MIRT2651143	hsa-miR-548ak	CLIP-seq
MIRT2651144	hsa-miR-548b-5p	CLIP-seq
MIRT2651145	hsa-miR-548c-3p	CLIP-seq
MIRT2651146	hsa-miR-548c-5p	CLIP-seq
MIRT2651147	hsa-miR-548d-5p	CLIP-seq
MIRT2651148	hsa-miR-548h	CLIP-seq
MIRT2651149	hsa-miR-548i	CLIP-seq
MIRT2651150	hsa-miR-548j	CLIP-seq
MIRT2651151	hsa-miR-548w	CLIP-seq
MIRT2651152	hsa-miR-548y	CLIP-seq
MIRT2651153	hsa-miR-559	CLIP-seq
MIRT2694189	hsa-miR-654-5p	CLIP-seq
MIRT2651157	hsa-miR-92a	CLIP-seq
MIRT2651158	hsa-miR-92b	CLIP-seq

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IBA	21873635
GO:0002230	Process	Positive regulation of defense response to virus by host	IMP	24882218
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IMP	24882218
GO:0005515	Function	Protein binding	IPI	25127057
GO:0005654	Component	Nucleoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	17156811, 24882218
GO:0005829	Component	Cytosol	IBA	21873635
GO:0008134	Function	Transcription factor binding	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA	21873635
GO:0010508	Process	Positive regulation of autophagy	IBA	21873635
GO:0010629	Process	Negative regulation of gene expression	IMP	24882218
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IMP	24882218
GO:0010994	Process	Free ubiquitin chain polymerization	IMP	24882218
GO:0016032	Process	Viral process	IEA
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0019901	Function	Protein kinase binding	IPI	24882218, 25127057
GO:0030674	Function	Protein-macromolecule adaptor activity	IPI	25127057
GO:0032496	Process	Response to lipopolysaccharide	IMP	24882218
GO:0032880	Process	Regulation of protein localization	IBA	21873635
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IMP	24882218
GO:0035458	Process	Cellular response to interferon-beta	IMP	24882218
GO:0042802	Function	Identical protein binding	IPI	17156811
GO:0042803	Function	Protein homodimerization activity	IBA	21873635
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	21873635
GO:0045071	Process	Negative regulation of viral genome replication	IMP	24882218
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IEA
GO:0046596	Process	Regulation of viral entry into host cell	IBA	21873635
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IBA	21873635
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IMP	24882218
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:0061630	Function	Ubiquitin protein ligase activity	IMP	24882218
GO:0098586	Process	Cellular response to virus	IEA
GO:1901222	Process	Regulation of NIK/NF-kappaB signaling	IMP	24882218
GO:1990782	Function	Protein tyrosine kinase binding	IPI	24882218
GO:2000679	Process	Positive regulation of transcription regulatory region DNA binding	IMP	24882218
GO:2000737	Process	Negative regulation of stem cell differentiation	IEA

MIM	HGNC	e!Ensembl
607564	16277	ENSG00000121236

Protein

UniProt ID

Q9C030

Protein name

Tripartite motif-containing protein 6 (EC 2.3.2.27) (RING finger protein 89) (RING-type E3 ubiquitin transferase TRIM6)

Protein function

E3 ubiquitin ligase that plays a crucial role in the activation of the IKBKE-dependent branch of the type I interferon signaling pathway (PubMed:24882218, PubMed:31694946). In concert with the ubiquitin-conjugating E2 enzyme UBE2K, synthesizes u

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13445	zf-RING_UBOX	15 → 57	RING-type zinc-finger	Domain
PF00643	zf-B_box	93 → 133	B-box zinc finger	Domain
PF00622	SPRY	354 → 483	SPRY domain	Family

Sequence

MTSPVLVDIREEVTCPICLELLTEPLSIDCGHSFCQACITPNGRESVIGQEGERSCPVCQ
TSYQPGNLRPNRHLANIVRRLREVVLGPGKQLKAVLCADHGEKLQLFCQEDGKVICWLCE
RSQEHRGHHTFLVEEVAQEYQEKFQESLKKLKNEEQEAEKLTAFIREKKTSWKNQMEPER
CRIQTEFNQLRNILDRVEQRELKKLEQEEKKGLRIIEEAENDLVHQTQSLRELISDLERR
CQGSTMELLQDVSDVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVCRELTDVQSYW
VDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFSSGKHYWEVD
VAKKTAWILGVCSNSLGPTFSFNHFAQNHSAYSRYQPQSGYWVIGLQHNHEYRAYEDSSP
SLLLSMTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPCNCVIP
MTLRRPSS

Sequence length

488

Interactions

View interactions

	Reactome
			Interferon gamma signaling

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Coronary artery disease	Coronary artery disease			GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Atherosclerosis	Associate	37370144
Cerebral Infarction	Associate	37370144
Fibrosis	Associate	38420829
Glioma	Associate	37759698
Inflammation	Associate	37759698
Virus Diseases	Associate	40296166
West Nile Fever	Associate	31694946

TRIM6 (tripartite motif containing 6)