Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	117854
Gene name	Tripartite motif containing 6
Gene symbol	TRIM6
Synonyms (NCBI Gene)	RNF89
Chromosome	11
Chromosome location	11p15.4
Summary	The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, B-box type 1 and B-box type 2 domain, and a coiled-coil region. The protein localizes to the nucleus, but its s

186

Show/Hide all (186)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029893	hsa-miR-26b-5p	Microarray	19088304
MIRT1455584	hsa-miR-129-5p	CLIP-seq
MIRT1455585	hsa-miR-3165	CLIP-seq
MIRT1455586	hsa-miR-331-5p	CLIP-seq
MIRT1455587	hsa-miR-3614-5p	CLIP-seq
MIRT1455588	hsa-miR-3616-5p	CLIP-seq
MIRT1455589	hsa-miR-3647-5p	CLIP-seq
MIRT1455590	hsa-miR-3656	CLIP-seq
MIRT1455591	hsa-miR-4433	CLIP-seq
MIRT1455592	hsa-miR-4678	CLIP-seq
MIRT1455593	hsa-miR-4768-3p	CLIP-seq
MIRT1455594	hsa-miR-573	CLIP-seq
MIRT1455595	hsa-miR-1273	CLIP-seq
MIRT1455596	hsa-miR-3613-3p	CLIP-seq
MIRT1455597	hsa-miR-371-5p	CLIP-seq
MIRT1455598	hsa-miR-371b-5p	CLIP-seq
MIRT1455599	hsa-miR-383	CLIP-seq
MIRT1455600	hsa-miR-3617	CLIP-seq
MIRT1455601	hsa-miR-641	CLIP-seq
MIRT2357383	hsa-miR-1206	CLIP-seq
MIRT2357384	hsa-miR-1236	CLIP-seq
MIRT2357385	hsa-miR-1279	CLIP-seq
MIRT2357386	hsa-miR-146a	CLIP-seq
MIRT2357387	hsa-miR-146b-5p	CLIP-seq
MIRT2357388	hsa-miR-300	CLIP-seq
MIRT2357389	hsa-miR-302a	CLIP-seq
MIRT2357390	hsa-miR-302b	CLIP-seq
MIRT2357391	hsa-miR-302c	CLIP-seq
MIRT2357392	hsa-miR-302d	CLIP-seq
MIRT2357393	hsa-miR-302e	CLIP-seq
MIRT2357394	hsa-miR-3154	CLIP-seq
MIRT2357395	hsa-miR-372	CLIP-seq
MIRT2357396	hsa-miR-373	CLIP-seq
MIRT2357397	hsa-miR-381	CLIP-seq
MIRT1455599	hsa-miR-383	CLIP-seq
MIRT2357398	hsa-miR-3926	CLIP-seq
MIRT1455591	hsa-miR-4433	CLIP-seq
MIRT2357399	hsa-miR-4666-3p	CLIP-seq
MIRT2357400	hsa-miR-4753-3p	CLIP-seq
MIRT1455593	hsa-miR-4768-3p	CLIP-seq
MIRT2357401	hsa-miR-4768-5p	CLIP-seq
MIRT2357402	hsa-miR-4789-5p	CLIP-seq
MIRT2357403	hsa-miR-519a	CLIP-seq
MIRT2357404	hsa-miR-519b-3p	CLIP-seq
MIRT2357405	hsa-miR-519c-3p	CLIP-seq
MIRT2357406	hsa-miR-520a-3p	CLIP-seq
MIRT2357407	hsa-miR-520b	CLIP-seq
MIRT2357408	hsa-miR-520c-3p	CLIP-seq
MIRT2357409	hsa-miR-520d-3p	CLIP-seq
MIRT2357410	hsa-miR-520e	CLIP-seq
MIRT2357411	hsa-miR-548ae	CLIP-seq
MIRT2357412	hsa-miR-548aj	CLIP-seq
MIRT2357413	hsa-miR-548am	CLIP-seq
MIRT2357414	hsa-miR-548s	CLIP-seq
MIRT2357415	hsa-miR-548x	CLIP-seq
MIRT2357416	hsa-miR-589	CLIP-seq
MIRT2357417	hsa-miR-599	CLIP-seq
MIRT2651094	hsa-miR-1229	CLIP-seq
MIRT2651095	hsa-miR-1231	CLIP-seq
MIRT1455595	hsa-miR-1273	CLIP-seq
MIRT2651096	hsa-miR-1278	CLIP-seq
MIRT2651097	hsa-miR-1285	CLIP-seq
MIRT2651098	hsa-miR-137	CLIP-seq
MIRT2651099	hsa-miR-148a	CLIP-seq
MIRT2651100	hsa-miR-148b	CLIP-seq
MIRT2651101	hsa-miR-152	CLIP-seq
MIRT2651102	hsa-miR-1825	CLIP-seq
MIRT2651103	hsa-miR-197	CLIP-seq
MIRT2651104	hsa-miR-1972	CLIP-seq
MIRT2651105	hsa-miR-25	CLIP-seq
MIRT2357388	hsa-miR-300	CLIP-seq
MIRT2651106	hsa-miR-3120-5p	CLIP-seq
MIRT2651107	hsa-miR-3122	CLIP-seq
MIRT2651108	hsa-miR-3128	CLIP-seq
MIRT2651109	hsa-miR-3133	CLIP-seq
MIRT1455585	hsa-miR-3165	CLIP-seq
MIRT2651110	hsa-miR-3178	CLIP-seq
MIRT2651111	hsa-miR-3187-5p	CLIP-seq
MIRT2651112	hsa-miR-32	CLIP-seq
MIRT2651113	hsa-miR-324-5p	CLIP-seq
MIRT2651114	hsa-miR-33a	CLIP-seq
MIRT2651115	hsa-miR-33b	CLIP-seq
MIRT2651116	hsa-miR-3607-3p	CLIP-seq
MIRT1455596	hsa-miR-3613-3p	CLIP-seq
MIRT2651117	hsa-miR-363	CLIP-seq
MIRT1455590	hsa-miR-3656	CLIP-seq
MIRT2651118	hsa-miR-367	CLIP-seq
MIRT2651119	hsa-miR-3686	CLIP-seq
MIRT2651120	hsa-miR-3689a-3p	CLIP-seq
MIRT2651121	hsa-miR-3689c	CLIP-seq
MIRT1455597	hsa-miR-371-5p	CLIP-seq
MIRT1455598	hsa-miR-371b-5p	CLIP-seq
MIRT2651122	hsa-miR-378g	CLIP-seq
MIRT2357397	hsa-miR-381	CLIP-seq
MIRT2651123	hsa-miR-3913-5p	CLIP-seq
MIRT2651124	hsa-miR-3960	CLIP-seq
MIRT2651125	hsa-miR-3973	CLIP-seq
MIRT2651126	hsa-miR-4284	CLIP-seq
MIRT2651127	hsa-miR-4438	CLIP-seq
MIRT2651128	hsa-miR-4470	CLIP-seq
MIRT2651129	hsa-miR-4479	CLIP-seq
MIRT2651130	hsa-miR-4486	CLIP-seq
MIRT2651131	hsa-miR-4495	CLIP-seq
MIRT2651132	hsa-miR-4511	CLIP-seq
MIRT2651133	hsa-miR-452	CLIP-seq
MIRT2651134	hsa-miR-4649-5p	CLIP-seq
MIRT2357399	hsa-miR-4666-3p	CLIP-seq
MIRT2651135	hsa-miR-4676-3p	CLIP-seq
MIRT2357402	hsa-miR-4789-5p	CLIP-seq
MIRT2651136	hsa-miR-4795-3p	CLIP-seq
MIRT2651137	hsa-miR-490-3p	CLIP-seq
MIRT2651138	hsa-miR-508-5p	CLIP-seq
MIRT2651139	hsa-miR-5095	CLIP-seq
MIRT2651140	hsa-miR-548a-5p	CLIP-seq
MIRT2651141	hsa-miR-548ab	CLIP-seq
MIRT2651142	hsa-miR-548ad	CLIP-seq
MIRT2651143	hsa-miR-548ak	CLIP-seq
MIRT2651144	hsa-miR-548b-5p	CLIP-seq
MIRT2651145	hsa-miR-548c-3p	CLIP-seq
MIRT2651146	hsa-miR-548c-5p	CLIP-seq
MIRT2651147	hsa-miR-548d-5p	CLIP-seq
MIRT2651148	hsa-miR-548h	CLIP-seq
MIRT2651149	hsa-miR-548i	CLIP-seq
MIRT2651150	hsa-miR-548j	CLIP-seq
MIRT2651151	hsa-miR-548w	CLIP-seq
MIRT2651152	hsa-miR-548y	CLIP-seq
MIRT2651153	hsa-miR-559	CLIP-seq
MIRT2651154	hsa-miR-612	CLIP-seq
MIRT2651155	hsa-miR-661	CLIP-seq
MIRT2651156	hsa-miR-766	CLIP-seq
MIRT2651157	hsa-miR-92a	CLIP-seq
MIRT2651158	hsa-miR-92b	CLIP-seq
MIRT2651094	hsa-miR-1229	CLIP-seq
MIRT2651096	hsa-miR-1278	CLIP-seq
MIRT2651098	hsa-miR-137	CLIP-seq
MIRT2651103	hsa-miR-197	CLIP-seq
MIRT2651104	hsa-miR-1972	CLIP-seq
MIRT2651105	hsa-miR-25	CLIP-seq
MIRT2357388	hsa-miR-300	CLIP-seq
MIRT2651107	hsa-miR-3122	CLIP-seq
MIRT2651108	hsa-miR-3128	CLIP-seq
MIRT2651112	hsa-miR-32	CLIP-seq
MIRT2651113	hsa-miR-324-5p	CLIP-seq
MIRT2651114	hsa-miR-33a	CLIP-seq
MIRT2651115	hsa-miR-33b	CLIP-seq
MIRT2651116	hsa-miR-3607-3p	CLIP-seq
MIRT1455596	hsa-miR-3613-3p	CLIP-seq
MIRT2651117	hsa-miR-363	CLIP-seq
MIRT1455590	hsa-miR-3656	CLIP-seq
MIRT2651118	hsa-miR-367	CLIP-seq
MIRT2651119	hsa-miR-3686	CLIP-seq
MIRT2651120	hsa-miR-3689a-3p	CLIP-seq
MIRT2651121	hsa-miR-3689c	CLIP-seq
MIRT1455597	hsa-miR-371-5p	CLIP-seq
MIRT1455598	hsa-miR-371b-5p	CLIP-seq
MIRT2357397	hsa-miR-381	CLIP-seq
MIRT2651123	hsa-miR-3913-5p	CLIP-seq
MIRT2651125	hsa-miR-3973	CLIP-seq
MIRT2651127	hsa-miR-4438	CLIP-seq
MIRT2651128	hsa-miR-4470	CLIP-seq
MIRT2651131	hsa-miR-4495	CLIP-seq
MIRT2651133	hsa-miR-452	CLIP-seq
MIRT2357399	hsa-miR-4666-3p	CLIP-seq
MIRT2651135	hsa-miR-4676-3p	CLIP-seq
MIRT2357402	hsa-miR-4789-5p	CLIP-seq
MIRT2651136	hsa-miR-4795-3p	CLIP-seq
MIRT2651137	hsa-miR-490-3p	CLIP-seq
MIRT2651139	hsa-miR-5095	CLIP-seq
MIRT2694188	hsa-miR-541	CLIP-seq
MIRT2651140	hsa-miR-548a-5p	CLIP-seq
MIRT2651141	hsa-miR-548ab	CLIP-seq
MIRT2651142	hsa-miR-548ad	CLIP-seq
MIRT2651143	hsa-miR-548ak	CLIP-seq
MIRT2651144	hsa-miR-548b-5p	CLIP-seq
MIRT2651145	hsa-miR-548c-3p	CLIP-seq
MIRT2651146	hsa-miR-548c-5p	CLIP-seq
MIRT2651147	hsa-miR-548d-5p	CLIP-seq
MIRT2651148	hsa-miR-548h	CLIP-seq
MIRT2651149	hsa-miR-548i	CLIP-seq
MIRT2651150	hsa-miR-548j	CLIP-seq
MIRT2651151	hsa-miR-548w	CLIP-seq
MIRT2651152	hsa-miR-548y	CLIP-seq
MIRT2651153	hsa-miR-559	CLIP-seq
MIRT2694189	hsa-miR-654-5p	CLIP-seq
MIRT2651157	hsa-miR-92a	CLIP-seq
MIRT2651158	hsa-miR-92b	CLIP-seq

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0002230	Process	Positive regulation of defense response to virus by host	IMP	24882218
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IMP	24882218
GO:0005515	Function	Protein binding	IPI	25127057
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	35263596
GO:0005737	Component	Cytoplasm	IDA	17156811, 24882218
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	24882218
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IMP	24882218
GO:0010994	Process	Free ubiquitin chain polymerization	IDA	35263596
GO:0010994	Process	Free ubiquitin chain polymerization	IMP	24882218
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	24882218, 25127057
GO:0030674	Function	Protein-macromolecule adaptor activity	IPI	25127057
GO:0032496	Process	Response to lipopolysaccharide	IMP	24882218
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IMP	24882218
GO:0035458	Process	Cellular response to interferon-beta	IMP	24882218
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	17156811
GO:0045071	Process	Negative regulation of viral genome replication	IEA
GO:0045071	Process	Negative regulation of viral genome replication	IMP	24882218
GO:0045087	Process	Innate immune response	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IDA	23386060
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IDA	24882218
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IDA	24882218
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IEA
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IMP	24882218
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	28679761, 35263596
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IMP	24882218
GO:0070936	Process	Protein K48-linked ubiquitination	IDA	24882218
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0098586	Process	Cellular response to virus	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140374	Process	Antiviral innate immune response	IDA	28469175, 35263596
GO:0140374	Process	Antiviral innate immune response	IDA	35263596
GO:1901222	Process	Regulation of non-canonical NF-kappaB signal transduction	IMP	24882218
GO:1990782	Function	Protein tyrosine kinase binding	IPI	24882218
GO:2000679	Process	Positive regulation of transcription regulatory region DNA binding	IMP	24882218
GO:2000737	Process	Negative regulation of stem cell differentiation	IEA

MIM	HGNC	e!Ensembl
607564	16277	ENSG00000121236

Q9C030

Protein name

Tripartite motif-containing protein 6 (EC 2.3.2.27) (RING finger protein 89) (RING-type E3 ubiquitin transferase TRIM6)

Protein function

E3 ubiquitin ligase that plays a crucial role in the activation of the IKBKE-dependent branch of the type I interferon signaling pathway (PubMed:24882218, PubMed:31694946). In concert with the ubiquitin-conjugating E2 enzyme UBE2K, synthesizes u

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13445	zf-RING_UBOX	15 → 57	RING-type zinc-finger	Domain
PF00643	zf-B_box	93 → 133	B-box zinc finger	Domain
PF00622	SPRY	354 → 483	SPRY domain	Family

Sequence

MTSPVLVDIREEVTCPICLELLTEPLSIDCGHSFCQACITPNGRESVIGQEGERSCPVCQ
TSYQPGNLRPNRHLANIVRRLREVVLGPGKQLKAVLCADHGEKLQLFCQEDGKVICWLCE
RSQEHRGHHTFLVEEVAQEYQEKFQESLKKLKNEEQEAEKLTAFIREKKTSWKNQMEPER
CRIQTEFNQLRNILDRVEQRELKKLEQEEKKGLRIIEEAENDLVHQTQSLRELISDLERR
CQGSTMELLQDVSDVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVCRELTDVQSYW
VDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFSSGKHYWEVD
VAKKTAWILGVCSNSLGPTFSFNHFAQNHSAYSRYQPQSGYWVIGLQHNHEYRAYEDSSP
SLLLSMTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPCNCVIP
MTLRRPSS

Sequence length

488

Interactions

View interactions

	Reactome
			Interferon gamma signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
METACHRONOUS COLORECTAL ADENOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Atherosclerosis	Associate	37370144	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	37370144	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	38420829	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	37759698	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	37759698	★★★★★ ★☆☆☆☆ Found in Text Mining only
Virus Diseases	Associate	40296166	★★★★★ ★☆☆☆☆ Found in Text Mining only
West Nile Fever	Associate	31694946	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRIM6 (tripartite motif containing 6)