Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
117531
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane channel like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMC1
Synonyms (NCBI Gene) Gene synonyms aliases
DFNA36, DFNB11, DFNB7
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q21.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is considered a member of a gene family predicted to encode transmembrane proteins. The specific function of this gene is unknown; however, it is known to be required for normal function of cochlear hair cells. Mutations in this gene have been a
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs113342704 C>A,G,T Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, synonymous variant, missense variant
rs121908072 G>A,C Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs121908073 C>T Pathogenic Coding sequence variant, stop gained
rs121908074 A>G Pathogenic Coding sequence variant, missense variant
rs121908076 T>C Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1427988 hsa-miR-1268 CLIP-seq
MIRT1427989 hsa-miR-1268b CLIP-seq
MIRT1427990 hsa-miR-128 CLIP-seq
MIRT1427991 hsa-miR-1285 CLIP-seq
MIRT1427992 hsa-miR-2117 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005245 Function Voltage-gated calcium channel activity IBA
GO:0005245 Function Voltage-gated calcium channel activity IEA
GO:0005262 Function Calcium channel activity IEA
GO:0005262 Function Calcium channel activity ISS
GO:0005886 Component Plasma membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606706 16513 ENSG00000165091
Protein
UniProt ID Q8TDI8
Protein name Transmembrane channel-like protein 1 (Transmembrane cochlear-expressed protein 1)
Protein function Pore-forming subunit of the mechanotransducer (MET) non-selective cation channel complex located at the tips of stereocilia of cochlear hair cells and that mediates sensory transduction in the auditory system (By similarity). The MET complex is
PDB 8XOQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07810 TMC 515 630 TMC domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in fetal cochlea, and at low levels in placenta and testis.
Sequence
MSPKKVQIKVEEKEDETEESSSEEEEEVEDKLPRRESLRPKRKRTRDVINEDDPEPEPED
EETRKAREKERRRRLKRGAEEEEIDEEELERLKAELDEKRQIIATVKCKPWKMEKKIEVL
KEAKKFVSENEGALGKGKGKRWFAFKMMMAKKWAKFLRDFENFKAACVPWENKIKAIESQ
FGSSVASYFLFLRWMYGVNMVLFILTFSLIMLPEYLWGLPYGSLPRKTVPRAEEASAANF
GVLYDFNGLAQYSVLFYGYYDNKRTIGWMNFRLPLSYFLVGIMCIGYSFLVVLKAMTKNI
GDDGGGDDNTFNFSWKVFTSWDYLIGNPETADNKFNSITMNFKEAITEEKAAQVEENVHL
IRFLRFLANFFVFLTLGGSGYLIFWAVKRSQEFAQQDPDTLGWWEKNEMNMVMSLLGMFC
PTLFDLFAELEDYHPLIALKWLLGRIFALLLGNLYVFILALMDEINNKIEEEKLVKANIT
LWEANMIKAYNASFSENSTGPPFFVHPADVPRGPCWETMVGQEFVRLTVSDVLTTYVTIL
IGDFLRACFVRFCNYCWCWDLEYGYPSYTEFDISGNVLALIFNQGMIWMGSFFAPSLPGI
NILRLHTSMYFQCWAVMCCNVPEARVFKAS
RSNNFYLGMLLLILFLSTMPVLYMIVSLPP
SFDCGPFSGKNRMFEVIGETLEHDFPSWMAKILRQLSNPGLVIAVILVMVLAIYYLNATA
KGQKAANLDLKKKMKMQALENKMRNKKMAAARAAAAAGRQ
Sequence length 760
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Deafness Autosomal recessive nonsyndromic hearing loss 7, Autosomal dominant nonsyndromic hearing loss 36 rs878853230, rs121908072, rs1169090943, rs727503483, rs121908076, rs775428246, rs757327146, rs151001642, rs1564555185, rs370898981, rs1564556995, rs786201027, rs1564554148, rs121908073, rs138527651
View all (2 more)
N/A
Hearing Loss Hearing loss, autosomal recessive rs1564555240, rs777777359, rs761261855, rs121908076, rs757327146, rs775428246, rs1564554255, rs1564556995, rs773851192, rs121908073 N/A
deafness Deafness rs761261855, rs1564554255, rs773851192, rs1564555240 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diverticulitis Diverticulitis N/A N/A GWAS
Nonsyndromic Deafness Nonsyndromic Hearing Loss, Dominant N/A N/A ClinVar
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alcoholism Associate 26458734
Deafness Associate 18616530, 22607986, 23226338, 23767834, 24926664, 24949729, 25388789, 26011067, 26879195, 27573290, 29434063, 29533536, 29692870, 30682115, 32802042
View all (3 more)
Deafness Autosomal Recessive Associate 24926664, 29270100
Deafness Autosomal Recessive 7 Associate 21250555, 34523024
Deafness oligodontia syndrome Associate 21250555
Death Associate 29270100
Hearing Disorders Associate 39684270
Hearing Loss Associate 18616530, 19180119, 21250555, 26079994, 26879195, 27573290, 28862181, 29196752, 29270100, 29692870, 32802042, 33205915, 33524517, 34523024, 35062939
View all (1 more)
Hearing Loss Sensorineural Associate 26822030, 26879195, 34795337
Hemochromatosis Associate 29270100