CIB3 (calcium and integrin binding family member 3)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 117286
Gene name Calcium and integrin binding family member 3
Gene symbol CIB3
Synonyms (NCBI Gene)
KIP3
Chromosome 19
Chromosome location 19p13.11
Summary This gene product shares a high degree of sequence similarity with DNA-dependent protein kinase catalytic subunit-interacting protein 2 in human and mouse, and like them may bind the catalytic subunit of DNA-dependent protein kinases. The exact function o
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene Gene ontology Other IDs Protein
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IBA
GO:0000287 Function Magnesium ion binding IDA 22779914
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 22779914
GO:0005509 Function Calcium ion binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
610645 24580 ENSG00000141977
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96Q77
Protein name Calcium and integrin-binding family member 3 (Kinase-interacting protein 3) (KIP 3)
Protein function Acts a an auxiliary subunit of the sensory mechanoelectrical transduction (MET) channel in hair cells (By similarity). Plays a role in regulating hair cell MET channel localization and function (By similarity).
PDB 6WU5 , 6WU7 , 6WUD
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13499 EF-hand_7 105 → 174 EF-hand domain pair Domain
Sequence 
MGNKQTVFTHEQLEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIG
SMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAFKIYDFNND
DYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADGDHDGRLSLEDFQNMILRAPDFL
STFHIRI
Sequence length 187
Interactions View interactions